PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000190306
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 307aa    MW: 34705.5 Da    PI: 6.3357
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000190306genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.1e-40251241100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rrkCakdC+lap+fp +qpk f+n+h+l+G++n++k+lk++++e+re+am+s++ye++++a+ Pv G++g+i++l+ ql+q+++el +
  MDP0000190306  25 ACAACKYQRRKCAKDCALAPHFPPDQPKLFQNAHRLYGVANIMKILKQVHPEKREEAMRSIIYESNMCAKFPVTGCMGIINQLTFQLQQAQEELRY 120
                    7*********************************************************************************************99 PP

         DUF260  97 lkee 100
                    ++++
  MDP0000190306 121 VRTH 124
                    9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.69824125IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3725122IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MMITKKVDEC TFYPTMTIKG GTSQACAACK YQRRKCAKDC ALAPHFPPDQ PKLFQNAHRL  60
YGVANIMKIL KQVHPEKREE AMRSIIYESN MCAKFPVTGC MGIINQLTFQ LQQAQEELRY  120
VRTHLAICKD QCQYRMPXSP QHYSCPSSQL QLGIPTNPDV AALTLYQQHQ YPYQYASGGS  180
GGTPWVANEY LANGLNGVYI DENDNMVKPX RFQHPYYDDN XVEQLMAIQS NLVPSQAFPI  240
HQEMDVPHDY DDIPFDTIAD DRQSYIESKE ACESSAESSF KGTQSIEHVS QNDLKSAAAC  300
FSLTSVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-26211257111LOB family transfactor Ramosa2.1
5ly0_B3e-26211257111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348215.20.0LOB domain-containing protein 27-like
TrEMBLA0A498J2U50.0A0A498J2U5_MALDO; Uncharacterized protein
STRINGXP_008348215.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-45LOB domain-containing protein 27