PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000187914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GRAS
Protein Properties Length: 510aa    MW: 57178.4 Da    PI: 6.437
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000187914genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2631e-80594292330
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl..fsevsPilkfs 94 
                    ++lL++cA+a++++d++laq++L+ l+++a +dgd++qRl+  f++AL ar ar  + ++ +a++ s+++ + +++++++++l  f +++P+++f+
  MDP0000187914  59 EQLLVHCAKAIETNDATLAQQILWVLNNIAPQDGDSNQRLTCAFLRALIARAARiGSCKVLAAMANSQANFTIHTHKFSVVELasFIDLTPWHRFG 154
                    79****************************************************5444667777777777666888888888789*********** PP

           GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl... 181
                    + +aN aIleaveg + vHi+D+++++++Q p+L +a+asR+    +pp l++T+ g +e +      ++ee+g++L +fA++ ++ +ef+v+   
  MDP0000187914 155 FTAANAAILEAVEGYSVVHIVDLSLTHCMQIPTLVDAIASRQdgnVSPPLLKLTVAGTMEDVppmLDLSYEELGSKLVNFARSRNIILEFRVIpss 250
                    ******************************************655569**********998898888999***********************988 PP

           GRAS 182 ....vakrledleleeLrvkp.gEalaVnlvlqlhrll..........................desvsleserdevLklvkslsPkvvvvveqea 246
                         a+ +e+l++++L   + gEal+Vn++++lh++                           ++s s++s r+ +Lk + +l P++vv+v++++
  MDP0000187914 251 ytdgFANLIEQLRVQNLVYAEsGEALVVNCHMMLHYISeealtlpainpnpsssgstssyafdvASSSSSSSLRTVFLKXLGGLDPTIVVLVNEDV 346
                    5555555666666666665559*****************************************9999999999*********************** PP

           GRAS 247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                    d++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a eg++r+er e + +W +r+++a F++v+++
  MDP0000187914 347 DLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-VCWKIENVIAYEGFQRVERLEPKCRWVQRMRNANFRSVSFG 429
                    ******************************************.99***********************************9876 PP

2GRAS45.61.2e-14430507293373
           GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                    +i+nv+a eg++r+er e + +W +r+++a F++v+++ +a++++k++l +++   + ++ e++ +vl+ k++++v+++aW
  MDP0000187914 430 KIENVIAYEGFQRVERLEPKCRWVQRMRNANFRSVSFGXDAVSEVKAMLDEHG---WGLKREEEDVVLTLKGHNVVFATAW 507
                    8**************************************************99...45777788888999*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.87632491IPR005202Transcription factor GRAS
PfamPF035143.5E-7859429IPR005202Transcription factor GRAS
PfamPF035144.2E-12430507IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MMQFTDTPPP TXHQIITTPY SNNLPIMMNK NQTYXTRLWP GFPTSKSLGT NFGDANCMEQ  60
LLVHCAKAIE TNDATLAQQI LWVLNNIAPQ DGDSNQRLTC AFLRALIARA ARIGSCKVLA  120
AMANSQANFT IHTHKFSVVE LASFIDLTPW HRFGFTAANA AILEAVEGYS VVHIVDLSLT  180
HCMQIPTLVD AIASRQDGNV SPPLLKLTVA GTMEDVPPML DLSYEELGSK LVNFARSRNI  240
ILEFRVIPSS YTDGFANLIE QLRVQNLVYA ESGEALVVNC HMMLHYISEE ALTLPAINPN  300
PSSSGSTSSY AFDVASSSSS SSLRTVFLKX LGGLDPTIVV LVNEDVDLTS NNLVCRLRSA  360
FNYLWIPYDT VDTFLPRGSK QRQWYEADVC WKIENVIAYE GFQRVERLEP KCRWVQRMRN  420
ANFRSVSFGK IENVIAYEGF QRVERLEPKC RWVQRMRNAN FRSVSFGXDA VSEVKAMLDE  480
HGWGLKREEE DVVLTLKGHN VVFATAWMPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B2e-344042818372Protein SHORT-ROOT
5b3h_E2e-344042818372Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.113110.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0060851e-31AP006085.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT28L24, TM0128, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008338421.20.0scarecrow-like protein 32
SwissprotQ9SN221e-167SCL32_ARATH; Scarecrow-like protein 32
TrEMBLM5VYZ60.0M5VYZ6_PRUPE; Uncharacterized protein
STRINGXP_008361432.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-163GRAS family protein