PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000185713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 166aa    MW: 18908.1 Da    PI: 9.6581
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000185713genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind54.53.2e-1712612069
                   EESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SS CS
   HSF_DNA-bind 20 swsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdee 69
                   sw + +nsf v++  ef++++LpkyFkh++f+SFvRQLn Y  +kv+ ++
  MDP0000185713 12 SWINGNNSFGVWNVPEFSRDILPKYFKHRKFSSFVRQLNAYVGEKVEGKR 61
                   688999***********************************988887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004157.9E-5482IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004477.2E-131159IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.103.9E-161259IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467856.12E-121258IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.8E-53244IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.8E-54557IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
GGRPSTDAFV SSWINGNNSF GVWNVPEFSR DILPKYFKHR KFSSFVRQLN AYVGEKVEGK  60
RTLRVEMPIV VIVIVISAMC LDYSMCPSYL VAQGCSLLWH LYTLTLFLPS IRPSPSKLDE  120
TLGEISPSPE KPLKSKVVHS NNLIIITVFE PRNEMHFVPL PKYRHL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.162852e-61bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.11e-18heat shock factor 1