PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000183071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 152aa    MW: 16496.8 Da    PI: 10.0645
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000183071genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.22.8e-19901494099
         DUF260  40 snvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                       +k+l++lpe++r da+ss+vyeA+ar+r+P+yG++g i++lq+q+ +l+a+la++++
  MDP0000183071  90 VVCMKILQELPESHRADAVSSMVYEANARIRNPIYGCAGAIFQLQKQIGELQAQLAKAQA 149
                    45689***************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.20245151IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-1792148IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MEFNAKTTTT MSPPPFSYSP SSSPSSPITS SFPSPNSHHL SNLSSPHAAN NDIGTNPLPT  60
SLFXHXHHRH RHRHLLXSAH APPARFSAAV VCMKILQELP ESHRADAVSS MVYEANARIR  120
NPIYGCAGAI FQLQKQIGEL QAQLAKAQAG AR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-149414754107LOB family transfactor Ramosa2.1
5ly0_B5e-149414754107LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376313.24e-46LOB domain-containing protein 1-like
RefseqXP_009333736.13e-46PREDICTED: LOB domain-containing protein 1-like
TrEMBLA0A498JHL79e-45A0A498JHL7_MALDO; Uncharacterized protein
STRINGXP_008376313.15e-46(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2586033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-21LOB domain-containing protein 1