PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000179288
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family G2-like
Protein Properties Length: 374aa    MW: 41376.3 Da    PI: 8.4192
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000179288genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32251304255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH rFv+ave+LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  MDP0000179288 251 PRMRWTSTLHGRFVHAVEHLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 304
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-15248304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-29249304IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-24251304IPR006447Myb domain, plants
PfamPF002498.7E-7252303IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MPLEGIFIEP STTRTTSSQI PDLSLHISPP NTTSSNSSSI FNSTTTNEPQ NPTTQAHTEL  60
SLGRCFTGGA HEQEPPQNPY QRQSFHLHSS NSHLSHLNHG VSLLDXSSSE GLRPIKGIPV  120
YHQNRSFPFL PMDNIITRDH HKDSKMCFYP RPPPPSFNHP SFPSAASHNT QSTPYFGGGG  180
ATGLEPMSRF NGFSSVDAFK SNNQLHHHHH LHHHNQYGIG GVXPISEGSH HGIMRSRFLP  240
KLPTKRSMRA PRMRWTSTLH GRFVHAVEHL GGHERATPKS VLELMNVKDL TLAHVKSHLQ  300
MYRTVKTTDK PAASSGQSDG SGEDDILSPI SSATDHHGLH NTQQFPEQRG LCDQSVRPDV  360
DCTSSTTLWS NSSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381352.20.0transcription repressor KAN1
TrEMBLA0A498J5350.0A0A498J535_MALDO; Uncharacterized protein
STRINGXP_008381352.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-54G2-like family protein