PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000176747
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 869aa    MW: 94874.4 Da    PI: 8.231
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000176747genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.51.9e-15629685359
                    XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                    ++kr+rr+ +NRe+ArrsR+RK+a++ eLe+ v +L  e + L k+l   ++++++ 
  MDP0000176747 629 DVKRARRMLSNRESARRSRRRKQAQMSELETQVGQLRVEHSGLLKRLTDVNQKYDNA 685
                    68********************************************99999998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.20.20.702.7E-9953307IPR013785Aldolase-type TIM barrel
SuperFamilySSF513661.6E-8753293IPR011060Ribulose-phosphate binding barrel
PfamPF002905.6E-9257307IPR002028Tryptophan synthase, alpha chain
TIGRFAMsTIGR002621.8E-9059307IPR002028Tryptophan synthase, alpha chain
HamapMF_0013135.71963312IPR002028Tryptophan synthase, alpha chain
CDDcd047241.83E-11367305No hitNo description
PROSITE patternPS00167097110IPR018204Tryptophan synthase, alpha chain, active site
Gene3DG3DSA:1.20.5.1702.0E-10626682No hitNo description
SMARTSM003383.1E-18627691IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.887629683IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.33E-10630682No hitNo description
PfamPF001702.6E-13630683IPR004827Basic-leucine zipper domain
PROSITE patternPS000360634649IPR004827Basic-leucine zipper domain
PfamPF124983.5E-27698820IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006568Biological Processtryptophan metabolic process
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004834Molecular Functiontryptophan synthase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 869 aa     Download sequence    Send to blast
MAAASSLKSA AGFLQLKKPQ NPLLLSSPNQ VSTISTKKFA PIAALTATPV VSLSQTFINL  60
KDQGKVAFIP YITAGDPDLS ITAEALKVLD SCGSDIIELG VPYSDPLADG PVIQAAATRS  120
LARGTNLNAI ISMLKEVIPQ LSCPIALFTY YNPILKRGIP EFMSTIKDVG VHGLVVPDVP  180
LEETEILRKE AAKNNIELVL LTTPTTPIDR MKAIAEASEG FLYLVSSIGV TGARASVNER  240
VPALLKEIKE TTKRPVAVGF GISKPEHAKQ VAGWGADGVI VGSAMVKLLG EAKTPEEGLK  300
ELATFTNQKL ALILCYTGHH INYSAHDTWQ IHTNQRWPPE KVPVHNYYSV PYITRIFLYF  360
VRSPIYKHES SHLVDENNKY RIFRTRTRAQ SMHSVFTADD SSDPFWALSS PAAEMNRSAS  420
EWAFEQFLDE FSTPAATPRQ SVAEQFPVSS AASCSVVSQS STSKRDDVDE EVVEIKKPDR  480
NRQQPPPQQL NHPPPPTVLD PAPKAPVNSD QYREFLKNRL DLACAAVALS RASSLTPVDL  540
GNLAENQSPV SKPSQLAPTR SLDKDSGNGL PMTQNEADAS PLGISASPAA QRRTPVLSKQ  600
TTSGSSKEDS DDDDLEGDIE INENMDPSDV KRARRMLSNR ESARRSRRRK QAQMSELETQ  660
VGQLRVEHSG LLKRLTDVNQ KYDNAAVDNR ILRADIETLR AKVKMAEESV KRVTGINPLL  720
LAMSNVANAG MPSVNNPMNA STNAAVPMQP NSNHLFHPGV PSMTTTPLHH QRLDTGFHVN  780
PPISLVGNRQ SNVGQPVVAG SNMTQNSSIP HTGNIDHMQQ PQPQQQPQPQ PQQQPQQPRP  840
RQQQQPRPGV SEALPGWDPQ LPHAVPKNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tjr_A1e-104533054252BX1
1tjr_B1e-104533054252BX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1643650RRSRRRKQ
2645650SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.136670.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008382956.10.0light-inducible protein CPRF2-like isoform X1
STRINGXP_008382956.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF340923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.11e-57basic leucine zipper 25