PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000172464
Common NameGATA7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 321aa    MW: 35536.3 Da    PI: 5.7252
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000172464genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.58.7e-19240273134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  MDP0000172464 240 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 273
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-8118317IPR016679Transcription factor, GATA, plant
SMARTSM004013.3E-14234288IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.94E-14236297No hitNo description
PROSITE profilePS5011411.174238270IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.1E-14238271IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.67E-14239288No hitNo description
PROSITE patternPS003440240265IPR000679Zinc finger, GATA-type
PfamPF003201.7E-16240273IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MEYCIEAKAL KSSLRRELAV KSTQHVLLEE LWCATGISGV PCEDFSVDDL LDLSNGEFED  60
GSVEEEEEEK ESVSVDDEIS NSSSLVLPDS DSGLATQLLV PDDDLAELEW VSHFVDDSLP  120
DLSLFHTIGT QKPEALLMNR FEPEPKPVPL RAPLFPFQVP VKPRTKRYKP ASRVWSSSSS  180
CSPSSSPCSS GFSFSTPCLI FNPVQSMDVF VGEPAAKKQK KKPAVQTGEG SIGGQFQRRC  240
SHCQVQKTPQ WRTGPLGPKT LCNACGVRFK SGRLFPEYRP ACSPTFSGAV HSNSHRKVLE  300
MRKRKDVGEP EPLLNRMIRS F
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.8720.0bud| cell culture| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280850.10.0GATA transcription factor 5-like
TrEMBLD9ZIZ40.0D9ZIZ4_MALDO; GATA domain class transcription factor
STRINGPOPTR_0009s12620.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-53GATA transcription factor 5