PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000171877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family SBP
Protein Properties Length: 508aa    MW: 56467.1 Da    PI: 7.6425
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000171877genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.45.7e-40161237177
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    +Cqv+gC++dl+  k+yh+rh+vC++hsk++vv+v+g++qrfCqqCsrfh l efD+ krsCrrrLa+hn rrrk+q
  MDP0000171877 161 TCQVHGCNMDLTFSKDYHKRHRVCDAHSKTAVVIVNGIKQRFCQQCSRFHLLAEFDDVKRSCRRRLAGHNLRRRKPQ 237
                    6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.4E-31158223IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.838159236IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-37160241IPR004333Transcription factor, SBP-box
PfamPF031102.2E-30162235IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MESWSFGSEG KGFLFPEEMD IPTDAFSRST RKALLELDNK TCFNFGKESV DSVXFMDLGF  60
PDINQGVEIL NGVIGNDSSY NSVASPCCLI SSSSSFGDGE SGSKFSSPVT ESNSMDSSMI  120
ALKLGGFADS RGGQNSQHSI SRERSKRAGN GMRSSCYHAP TCQVHGCNMD LTFSKDYHKR  180
HRVCDAHSKT AVVIVNGIKQ RFCQQCSRFH LLAEFDDVKR SCRRRLAGHN LRRRKPQLDT  240
LDCKPHKLIR SCEGNGYMGT SFSKGTPFVF SDILPDGCIL YPEYEEANLY GHVKSEDRST  300
YGQSVTPIPN RQFIPKSFRH LPGLGEQHAP GIXSSGNEYS VFDTASTXEK AFETPYSSCA  360
LSLLSAQSHN LSSNSAGVQV PSPLINQRAH RSFGQLNEKT LRVNSMENCG RNRSYPFSMK  420
SMGAXHMESI KISDSSHAAD FQLHTDRALH VSDCLSDKYC VSPERGTTFD LRQLSSHLQR  480
VEHERNFFQV KQENGEFYCF PTGVQATM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-261622351184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.20991e-154bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389392.20.0squamosa promoter-binding-like protein 6
TrEMBLA0A498IE390.0A0A498IE39_MALDO; Uncharacterized protein
STRINGXP_008360085.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-36SBP family protein