PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000169910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family G2-like
Protein Properties Length: 386aa    MW: 43066.4 Da    PI: 10.1957
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000169910genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.43.7e-29255308255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ  R+
  MDP0000169910 255 PRMRWTSTLHARFVHAVEFLGGHERATPKSVLELMDVKDLTLAHVKSHLQGNRM 308
                    9*************************************************8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.13E-13252309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-26253312IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-21255307IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MPLEGIFREP SSATTTTSSX PIPDLSLHIS PPNTSSNSSS IXNTTISETQ NPTTSNSQAH  60
TELSLGRCFT GGAHEQEPPQ NPYQQQSFHL HRSNSHLSHL NHGVSLLDVS SSEGLRPIKG  120
IPVYHQNRSF PFLPMDNMIT RDHHKDSRMC FYPKPPPPSS YNHLSFPSAA SCSPNTPSAP  180
YFGGGAGGLD PMSRFTRFSS VDVFKSNNQL HHHHHLHQLH HHNHYGIGGV GPMSEGIMRS  240
RFLPKLPTKR SMRAPRMRWT STLHARFVHA VEFLGGHERA TPKSVLELMD VKDLTLAHVK  300
SHLQGNRMDL ARTTSSLRFA AQRISMPYAI LSNFQSKVDR PIGLCNQRRT TLPVPLFGVT  360
LQGRVFITLF LSLMLYIYMP ELLNSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14256307354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14256307354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14256307354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14256307354Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14256307455Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028953007.10.0transcription repressor KAN1-like
TrEMBLA0A498HAR00.0A0A498HAR0_MALDO; Uncharacterized protein
STRINGXP_008343064.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-38G2-like family protein