PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000167580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 189aa    MW: 21705.7 Da    PI: 9.2596
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000167580genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.81.9e-19139185147
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 
                    +CaaCk+lrr+C+++C+++pyf  ++p+kfa vhk+FGasnv+k+l 
  MDP0000167580 139 PCAACKLLRRRCSQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLM 185
                    7********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.19138189IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-19139185IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MFDRFKFXLN HMGLLVLAIF KYKLWFSYGD RYKISFSEQD TDTGFFITAP YFILPSFLQS  60
LSFSFSNSTS PSLPWESMPG CPEKVVLYVS SQFCLCISAS RERFDEVGKK FXRETDASHY  120
QMGRRHMLGP PGTLNTITPC AACKLLRRRC SQECPFSPYF SPHEPQKFAS VHKVFGASNV  180
SKMLMVIKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-18131184356LOB family transfactor Ramosa2.1
5ly0_B4e-18131184356LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-48LOB domain-containing protein 15