PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000163095
Common NameHD1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 289aa    MW: 31926.7 Da    PI: 8.2168
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000163095genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.5e-19144198256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  MDP0000163095 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 198
                    788899***********************************************98 PP

2HD-ZIP_I/II124.83.8e-40144233191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  MDP0000163095 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 233
                    69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-18130198IPR009057Homeodomain-like
SuperFamilySSF466894.6E-19133201IPR009057Homeodomain-like
PROSITE profilePS5007117.718140200IPR001356Homeobox domain
SMARTSM003891.0E-15142204IPR001356Homeobox domain
PfamPF000463.3E-16144198IPR001356Homeobox domain
CDDcd000861.87E-17144201No hitNo description
PROSITE patternPS000270175198IPR017970Homeobox, conserved site
SMARTSM003409.7E-25200243IPR003106Leucine zipper, homeobox-associated
PfamPF021835.6E-10200234IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGFDDHACNT GLVLGLGLTS SAPQESCNLT KFAKNNIKPS LNSAPTSGAF EPSLTLGLSG  60
EPYHQQTVAS NIYKVGNSSQ DEAIDLYRQA AAASSPHSHS AVSNSFSSGR VVKRERDLSS  120
EEVDVDEKVS SRVSDEDEDG SNARKKLRLT KEQSALLEES FKQHSTLNPK QKQALARQLN  180
LRPRQVEVWF QNRRARTKLK QTEVDCEFLK KCCETLTDEN RRLQKELQEL KALKLNQPLY  240
MHMPTATLTM CPSCERIGGA GSEGSSKSPF SMASKPHFYN HFTNPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192200RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.114800.0bud| cell culture| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280933.10.0homeobox-leucine zipper protein HAT22-like
SwissprotP466041e-100HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLD9ZJ030.0D9ZJ03_MALDO; HD domain class transcription factor
STRINGXP_008342690.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.16e-84HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]