PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000156088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 513aa    MW: 58370.5 Da    PI: 5.3475
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000156088genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind81.71.1e-251574261
                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
   HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                   Fl+k+y++++d++ ++++swse+g+sfvv+d++efak++Lp yFkh+nf+SFvRQLn+Y 
  MDP0000156088 15 FLTKTYDLVDDPSSNHMVSWSETGSSFVVWDPTEFAKEMLPMYFKHNNFSSFVRQLNTYW 74
                   9**********************************************************4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004158.7E-4211197IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.75E-241279IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.106.8E-341281IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.0E-151538IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.1E-2515197IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.0E-155365IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.0E-156678IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.106.8E-34165197IPR011991Winged helix-turn-helix DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MDGSQGGSGG APAPFLTKTY DLVDDPSSNH MVSWSETGSS FVVWDPTEFA KEMLPMYFKH  60
NNFSSFVRQL NTYWDYKLQN CCKHGDADII FCIIVLFTIV VFDCECTSPV WPLLEKVGTL  120
LAHGVEASPE SFQDMLPYGG QQFRGIFWIR ESKGCKYFLC CTVMEHGFRK IDPEQWEFAN  180
EEFLRGGRHL LTNIHRRKPI HSHSLQNHEY SSVPLTDTER EEYEKKINRL NHDKSLLELE  240
VQRHQRESQE FEFQIQILRE QLQNMENRQR QYTAFLAQLV QKPGFASVLV QQSEIHSKKR  300
RLLKSNHFPD DFGMEDLTLN PQKETLGIKL DQXEKMESSL NFWXDFLHGV GEAMPEEVND  360
IGPLSQASPI IVTEIQDTSM NSRPCSPRSH ISSPNSMNAH SFPEVAGSAN LFDILAITSM  420
CHTVDFRSKS SGIDMNSKPD XAPALDSSKE NVVQVKNAEP AKANDVFWEQ CLTETPGLDD  480
AAXVQSERSD GDGXKRVMPI RLFGRSFGGT QIM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A2e-176731278Heat shock factor protein 1
5d5u_B2e-176731987Heat shock factor protein 1
5d5v_B2e-176731987Heat shock factor protein 1
5d5v_D2e-176731987Heat shock factor protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.163140.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381180.20.0heat stress transcription factor A-4b-like
TrEMBLA0A498J3C60.0A0A498J3C6_MALDO; Uncharacterized protein
STRINGXP_008381180.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141001620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45710.11e-47HSF family protein