PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000153290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 369aa    MW: 41855.1 Da    PI: 6.5901
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000153290genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.81.8e-38711711101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rrkC+++C+lapyfpa+qpk ++n+hklFG+ n+lk+lk+l++ ++ +am+s++y+A+ r + PvyG+ +vi++lq q+  +++el++
  MDP0000153290  71 ACAACKYQRRKCTAECPLAPYFPADQPKMYQNAHKLFGVCNILKILKNLNPRQKVEAMRSIIYQANLRDKFPVYGCWEVIRQLQYQILVAEEELQA 166
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    ++++l
  MDP0000153290 167 VHQQL 171
                    *9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.55770171IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-3671168IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MLSIPPPPFL LPLLLLLQLT ATLLLLLFNF KHCTTLLSNC FRGFSRSRLS DWFRLRFGIR  60
KMPLKGATLQ ACAACKYQRR KCTAECPLAP YFPADQPKMY QNAHKLFGVC NILKILKNLN  120
PRQKVEAMRS IIYQANLRDK FPVYGCWEVI RQLQYQILVA EEELQAVHQQ LAMYRQHRHH  180
QISSMPEYVT SQLELGMAPP NNPLALFDYN LPPYILTNTN NATAVALVNQ HQQQSYSSSS  240
DAAYSSAAYN SDSKDNVNNS NNNAGNPLWS SNPFMTNNSN NNNNNNNSEA IESELGALQQ  300
LSIQPDVVQD YDELHPFFDT TDDRQSYIDS KEAYDSSSEE SFKDTTQSME HAENALKNDA  360
ACFSLTSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-267217412114LOB family transfactor Ramosa2.1
5ly0_B2e-267217412114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028959841.10.0LOB domain-containing protein 27-like
TrEMBLA0A498JK570.0A0A498JK57_MALDO; Uncharacterized protein
STRINGXP_008346755.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.16e-48LOB domain-containing protein 27