PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000149339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family SBP
Protein Properties Length: 1012aa    MW: 112200 Da    PI: 8.1862
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000149339genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.2e-40148225178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cqv++C++dls+ak+yhrrhkvCevhsk++ +lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  MDP0000149339 148 MCQVDNCKEDLSNAKDYHRRHKVCEVHSKSTRALVAKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 225
                    6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-34142210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.966146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-37147227IPR004333Transcription factor, SBP-box
PfamPF031103.0E-29149222IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1012 aa     Download sequence    Send to blast
MENAGGQVAA PIYIHRTLSG RFCDSPVMGR KRDLPYQGPN YQHPHSQQPR FANPGNDWNP  60
RVWDWDTVRF VAKPLDSRMM HLGSTSTTEQ RNKEEASGPV KDTAEDEDDE SLQLNLAGGF  120
TSVEEPVPRP NKRVRSGSPG NGNGNYPMCQ VDNCKEDLSN AKDYHRRHKV CEVHSKSTRA  180
LVAKQMQRFC QQCSRFHPLS EFDEGKRSCR RRLAGHNRRR RKTQPEDVTS RLTLPGDGDN  240
KIIGNSDIIN LLAAIARPQG KNDVRNINGS SVLDREQLLR VLSKINSLPL PAELAAKLPN  300
LGSLTRKASE LLSLDLQNKL NGRASASTMD LLTVLSATLA TSAPEAHAKL SQKCSQSSDS  360
EKTKLTCSDQ AAEPNLHKIP PQEIHSAGGE RSSTSYQSPM EDSDCQVQEA RVNLPLQLFS  420
SSPENDSPPK LASSRKYFSS DSSNPTEDRS PSSSPPVVQT LFPLKSLAET VKSEKLLVSK  480
EGSANPDTSW TCGSNMPFDL FRGSNKGAEA SSIQNFPNQP GYTSSGSDHS PSSLNSDVQD  540
RTGRILFKLF DKDPSHLPGT LRTQIXNWLS SSPSEMESYI RPGCVVLSVY VSMPSASWXQ  600
LEENLVQRVS SLVQSSDSDF WRSGRFLVNT GRQLASHKDG KIHCTYMGGY TSKEATGSAC  660
RGTMYDEINL GSFQIHDASP GVLGRCFIEV ENGFKGNSFP VIIADATICR ELKVLESVFD  720
AEAKVCDVIS VAGXHDYGRP TSRDEVLHFL NELGWLFQRK RICSMLQEPH YTLSRFKFLL  780
XFTVEKDCCA LVKTLLDILF ERNFDSDALS GGLVMLSDMQ LLNRAVKRRC RKMVDLLINY  840
STANRDSDKR YIFPPNLAGP GGMTPLHLAA CMSSTDDIID ALTNDPLEAY ALMRNNYSYN  900
NLVARKLADR RNSQITVTIG NERDQHQMSM ELEHRTSTQF RQGSRSCTKC AIAATKYTRR  960
VPGAQGLLQR PFIHSMLAIA AVCVCVCLFL RGLPDIGLVA PFKWENLGYG TI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-30141222384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1823828RAVKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.69950.0fruit| leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028960159.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A498JSE00.0A0A498JSE0_MALDO; Uncharacterized protein
STRINGXP_008373366.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]