PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000148722
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 438aa    MW: 48830.9 Da    PI: 5.1068
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000148722genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind106.52.2e-33221132102
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSEEEEESXXXXXXXXXXXXX CS
   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiweFkhksFkkgkkelleki 97 
                    Fl+k ye+++d++++++iswse+g+sf++ld+ +f+ ++LpkyFkhsnf+SF+RQLn+YgF+k++++          w F+++ F +g+k ll++i
  MDP0000148722  22 FLRKCYEMVDDKDTDSIISWSETGDSFAILDMAQFSISMLPKYFKHSNFSSFMRQLNIYGFRKIDSDX---------WVFANEGFIRGQKILLKNI 108
                    9***************************************************************9998.........******************* PP

                    XXXXX CS
   HSF_DNA-bind  98 krkks 102
                     r+k+
  MDP0000148722 109 ARRKH 113
                    **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF467851.21E-3118111IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.6E-4918111IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.101.1E-3418111IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004477.6E-2922111IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000567.8E-192245IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000567.8E-196072IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS0043406185IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000567.8E-197385IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MVKSAEKGGG DGSGPAGSVA PFLRKCYEMV DDKDTDSIIS WSETGDSFAI LDMAQFSISM  60
LPKYFKHSNF SSFMRQLNIY GFRKIDSDXW VFANEGFIRG QKILLKNIAR RKHPQGTDQK  120
XASQQXPDXP SENISENGLW REVENXKTDK VAXKQELAKL RQHQETSQNN LRLLRNRLCG  180
MEKNQQQMLS FLVTAMQSPG FLVQLLHPKE NNWRIAEAGD XLEQCGDDDR PVVSSGAIVR  240
YQPPMIDAXK HVLPPNSGSE KQPESDAYLD GMEDFVVNAD FMKMLMDEKS SPVENHDPYT  300
LPDISDDGAW EQLLLGGPFL ENIEGTMENG EEHADTRMEV ESIVFSIGSS DSFSWTLFSP  360
SLVHNSVLTN DKCVHGWMAF AKPNAXADAM APMNAVWKAL EKGLLSVKRP LAYPNISNAS  420
KVTTTDATRA SLALGKKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B8e-2671119129Heat shock factor protein 1
5d5v_B8e-2671119129Heat shock factor protein 1
5d5v_D8e-2671119129Heat shock factor protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.23570.0fruit| leaf| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360024.20.0heat stress transcription factor A-8-like
SwissprotQ9S7U59e-92HSFA8_ARATH; Heat stress transcription factor A-8
TrEMBLA0A498IA980.0A0A498IA98_MALDO; Uncharacterized protein
STRINGXP_008389155.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF104192937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67970.11e-88heat shock transcription factor A8