PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000140568
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family ARR-B
Protein Properties Length: 707aa    MW: 79088.2 Da    PI: 7.412
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000140568genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.31.5e-27204257155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+  LH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  MDP0000140568 204 KPRVVWSVXLHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 257
                    79*******************.********************************8 PP

2Response_reg77.93.6e-26201281109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl vdD+p+ ++ll+ +l++ +y +v++++++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +g+ +++ + +  Ga
  MDP0000140568  20 VLAVDDDPICLKLLEALLRRCQY-HVTTTSHAFTALKLLRENKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGDHKLVMKGITHGA 113
                    799********************.***************888888*******************87754.558*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +e+l +
  MDP0000140568 114 CDYLLKPVRIEQLKN 128
                    ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.5E-1641636IPR017053Response regulator B-type, plant
SuperFamilySSF521726.26E-3517140IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.4E-4117169No hitNo description
SMARTSM004483.2E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.03519134IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.8E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.82E-2621134No hitNo description
SuperFamilySSF466898.24E-19201261IPR009057Homeodomain-like
PROSITE profilePS5129410.771201260IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-29202262IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-24204257IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MTVERVLDEP RDQFPIGMRV LAVDDDPICL KLLEALLRRC QYHVTTTSHA FTALKLLREN  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSVNG DHKLVMKGIT HGACDYLLKP  120
VRIEQLKNIW QHVIRRKKVD SKDQNSGNQD KSAGCGEGGV GSVGTGNSDQ NAKLNKKRKD  180
QNDGEDEDHD EDEYENDDPS TQKKPRVVWS VXLHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQKYRLYLK RISCVANQQA NMVAALGTSD SSYLRTASMN GVGNYHXLTG  300
PAQFHNNGYR SFPPXGMIGR LNTPAGVGLH CLPSSGMFQL GHAQNPSNAI NDQPVMFPGN  360
RNGNMLPPHL ELDQQHNRGS TYGAPIYPDS SGFTDTKVTN RSNDPFGLTD NTMLRHTRDS  420
EVGRNHVMQS SVSMPSLKPV LAXPFLDHGR LNDNWPTAAQ PSAFRSNSFS AVDSFKQPTL  480
LDSRIGSQIP ASTMSNNSDP TINNDLFLGW DEPKQDSPFQ SDVMCSSMNN LMPVNDNVAP  540
SHQNLDARSS AFQRNSEFNL IGQPNFLDPL LMNYDGVEIS TMDAPLKLKQ QGYLMDQRKP  600
QGVYVPHNAG SLDELVSSMI KQVRSFSTGL FYCQIHKHPV RPACWPDXKN SWAGWWTRQN  660
EIISHCLPAA YMYRLQLLGR LLAHLHAINF LSKGDRRNHR EEGSIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-25200263164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.80440.0bud| fruit| leaf| root| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008377662.20.0two-component response regulator ARR12
SwissprotA2X1N21e-143ORR24_ORYSI; Two-component response regulator ORR24
SwissprotQ6H8051e-143ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A498J7D60.0A0A498J7D6_MALDO; Two-component response regulator
STRINGXP_008377662.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-126response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]