PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000140220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 315aa    MW: 34673.5 Da    PI: 9.4594
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000140220genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1360104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    MDP0000140220  60 RESWTEQEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 104
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.94E-1654110IPR009057Homeodomain-like
PROSITE profilePS5129414.98655109IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-758110IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-1858107IPR006447Myb domain, plants
SMARTSM007177.9E-1159107IPR001005SANT/Myb domain
PfamPF002493.3E-1160104IPR001005SANT/Myb domain
CDDcd001671.99E-862105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGLPGLNPMP PPTTGAASAT AATSTTAACT SSSAPANAAS MSADDQSKKI RKPYTITKSR  60
ESWTEQEHDK FLEALQLFDR DWKKIEAFIG SKTVIQIRSH AQKYFLKVQK KGTSEHVPPP  120
RPKRKATHPY PQKAPKSAAX VSQVAGPFQS SSXLLEHGYV YQPDSSIVLG TPVNAATLLS  180
WSYNSVPPVN VXQTIKDEGR LSGPTVTHNS CYSSSNESNP TNWKVSETVD RVDPGQPHRV  240
LPDFAQVYKF IGSVFDPSAI SHLERLRQLD PINFETALLL MRNLSINLTS PEFQDHVSVH  300
LLNFSMSFLT AVWMP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.166160.0bud| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008354011.20.0protein REVEILLE 3-like
SwissprotQ6R0H03e-97RVE3_ARATH; Protein REVEILLE 3
TrEMBLA0A498KI090.0A0A498KI09_MALDO; Uncharacterized protein
STRINGXP_008343412.10.0(Malus domestica)
STRINGXP_008345636.10.0(Malus domestica)
STRINGXP_008354011.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.16e-97MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]