PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000135540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 340aa    MW: 37681 Da    PI: 8.5912
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000135540genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.68.9e-18187241256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  MDP0000135540 187 RKKLRLSKDQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 241
                    678899***********************************************98 PP

2HD-ZIP_I/II126.51.2e-40187276191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk kq+E+d+e+Lkr++++l+een+rL+ke ++Lr +l
  MDP0000135540 187 RKKLRLSKDQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKXKQTEVDCEYLKRCCETLTEENRRLQKELQDLR-AL 276
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.2E-770149IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.1E-17171244IPR009057Homeodomain-like
SuperFamilySSF466893.46E-18178245IPR009057Homeodomain-like
PROSITE profilePS5007117.394183243IPR001356Homeobox domain
SMARTSM003897.5E-16185247IPR001356Homeobox domain
CDDcd000868.30E-16187244No hitNo description
PfamPF000462.9E-15187241IPR001356Homeobox domain
PROSITE patternPS000270218241IPR017970Homeobox, conserved site
SMARTSM003401.1E-25243286IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-10243277IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MELALSLGDA SKPFLFLDKT QKMGGTMDIG FCMGLGTAAF GAARSDESSR KSTYEVYDQE  60
ERRRSRISSD PPLQLNLLPS APVPRSHVSS QLRFPWLTDN LAVSEPAGSS DGPGIGLDVN  120
RMPGVLASAE EAEDAAAPLS SPNSTVSSFQ MDFGMRNGGR SSKRDLDVDA DRASSRASDD  180
EENGSTRKKL RLSKDQSAFL EESFKEHSTL NPKQKLALAK QLNLRPRQVE VWFQNRRART  240
KXKQTEVDCE YLKRCCETLT EENRRLQKEL QDLRALKTSQ PFYMQLPATT LTMCPSCERV  300
VTTASANTST TTTTTNNNHH HHIKSAMNNN KPRLNPFAAA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185191TRKKLRL
2235243RRARTKXKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.264470.0leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008387219.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-104HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A498IDI20.0A0A498IDI2_MALDO; Uncharacterized protein
STRINGXP_008387219.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-77homeobox from Arabidopsis thaliana