PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000133698
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 356aa    MW: 40177.4 Da    PI: 6.7039
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000133698genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.81.8e-11211256550
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                    kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  MDP0000133698 211 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQSEVSALSPRVA 256
                    899**********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-15207271IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.772209261IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11211265No hitNo description
PfamPF001701.2E-9211255IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-12211262No hitNo description
CDDcd147031.05E-22212262No hitNo description
PROSITE patternPS000360214229IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MAQLPPKIPS MTQNWPSFPH QRLPAMANFI PTATTTSAAA VQPSSNQPNQ QQQSSSCNWM  60
DEFLDFSSAR RGAHRRSASD SIAFLESPLI LDEECRNPTA TMMHHHGSTN NLGFDRLDDE  120
QLMSMFSDDM SVTVPPTISS SNPSTPSDQN SNNDENNINN GNNNNMKPLM LHLDQQQQPK  180
TEPGEVESSS CEADANAQSH PPPPTSPADP KRVKRILANR QSAQRSRVRK LQYISELERS  240
VTTLQSEVSA LSPRVAFLDH QRLILNVDNS ALKQRIAALA QDKLFKDAHQ EALKKEIERL  300
RQVYHHQTLK KMDNQGNRNQ NAQQHQQQQQ QQQQQQQQSN PDIMVCTDHN EQQILN
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028944886.10.0basic leucine zipper 34-like
SwissprotQ9M2K41e-100BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A498IJ460.0A0A498IJ46_MALDO; Uncharacterized protein
STRINGXP_008386228.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20113488
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.25e-75bZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]