PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000131978
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 196aa    MW: 21503.6 Da    PI: 7.7559
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000131978genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26036.21.7e-1137815397
         DUF260 53 eredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                   + +++++s++yeA+ r+ +P yG+vg++++++++ +q++++++l 
  MDP0000131978 37 HVPAIFKSVLYEACGRIVNPTYGSVGMMWSGSWDQCQAAVDAVLE 81
                   45889*********************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.8E-63877IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MSNPGIKPRQ SVHQTCFRTP ADLECSTVRP SRARACHVPA IFKSVLYEAC GRIVNPTYGS  60
VGMMWSGSWD QCQAAVDAVL EGPPITGIDA DALQQNTNPN LDPPHISGDI RYVSTDTNSG  120
CSSRNKARTL EQVEKILQPG QTSIIWHQSA MFPTRMTCTR VRKETGLAEI SKLLMIEMER  180
PELALGLVLP LPTNVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356758.15e-49PREDICTED: LOB domain-containing protein 42-like
SwissprotQ9CA303e-25LBD42_ARATH; LOB domain-containing protein 42
TrEMBLA0A498I8Q71e-99A0A498I8Q7_MALDO; Uncharacterized protein
STRINGXP_008360156.12e-67(Malus domestica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68510.11e-27LOB domain-containing protein 42