PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000124827
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 299aa    MW: 33786.6 Da    PI: 7.0511
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000124827genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.9e-1882134456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  MDP0000124827  82 KKRLNLEQVKTLEKSFEIGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWK 134
                    4568889*********************************************9 PP

2HD-ZIP_I/II129.81.1e-4180170191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprqva+WFqnrRAR+ktkqlEkdy++Lk+++dalk++n++L++++++L++el
  MDP0000124827  80 EKKKRLNLEQVKTLEKSFEIGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKKKFDALKADNDALQAHNKKLQAEL 170
                    69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-2054137IPR009057Homeodomain-like
SuperFamilySSF466898.98E-2071138IPR009057Homeodomain-like
PROSITE profilePS5007117.18476136IPR001356Homeobox domain
SMARTSM003895.9E-1879140IPR001356Homeobox domain
CDDcd000865.55E-1781137No hitNo description
PfamPF000461.1E-1582134IPR001356Homeobox domain
PRINTSPR000318.6E-6107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000318.6E-6116132IPR000047Helix-turn-helix motif
PfamPF021834.0E-15136176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAFPPCHTFM FQNHEDPDLH LANSSCPPQH FHGGGMPFMM KRSLSFSGVE NNKCHHHDQE  60
AALHGGGEDD LSDDGSQMGE KKKRLNLEQV KTLEKSFEIG NKLEPERKMQ LAKALGLQPR  120
QVAIWFQNRR ARWKTKQLEK DYDVLKKKFD ALKADNDALQ AHNKKLQAEL LALKSKDSSN  180
EGGFNFKKET DQGSWSNGSE NSSGHHHHLN LEISRTPTTT SSPPSDSPHE MNGKNLFPPS  240
SSSLRSASIT QPLQGSSRSD LQCLKVDQMI QDEGLCSMFN GIDQEHQGFW PWPEQHHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.243140.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379342.20.0LOW QUALITY PROTEIN: homeobox-leucine zipper protein HAT7-like
SwissprotQ004664e-85HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A498J2390.0A0A498J239_MALDO; Uncharacterized protein
STRINGXP_008379342.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-73homeobox 3