PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000123013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 230aa    MW: 25013 Da    PI: 6.2184
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000123013genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.67.5e-42751741100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll+++pe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+ +l+a+la+
  MDP0000123013  75 PCAACKILRRRCVEKCVLAPYFPPTEPLKFTVAHRVFGASNIIKLLQEIPESHRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVGELQAQLAQ 170
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MDP0000123013 171 AQAE 174
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.83274175IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-4275172IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEFIAXTTTT PTSPPPFSHS PSSSISSPST APFPSPXSHH LSNYSSPHAA NSNIATNPFP  60
TYPSPPPPPP VVLSPCAACK ILRRRCVEKC VLAPYFPPTE PLKFTVAHRV FGASNIIKLL  120
QEIPESHRAD AVSSMVYEAN ARIRDPVYGC AGAICQLQKQ VGELQAQLAQ AQAELVNMQC  180
EQGNLIALIC MDMTQSKEQA ILQQQLSSCN DTICFPDENN LGTTWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-42671853122LOB family transfactor Ramosa2.1
5ly0_B2e-42671853122LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369390.21e-167LOB domain-containing protein 1-like
SwissprotQ9LQR02e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A498KNK61e-116A0A498KNK6_MALDO; Uncharacterized protein
STRINGXP_008354087.11e-167(Malus domestica)
STRINGXP_008369390.11e-167(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-61LOB domain-containing protein 1