PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000121821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 157aa    MW: 17816.2 Da    PI: 6.8577
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000121821genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.11.9e-4081071100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaC++lrr+C++dCvlapyfp+++p++fa+vhk+FGa n++k+l++lp + re+a++s++yeA  r++dPvyG+v++i++lq+++ ++++e+ +
  MDP0000121821   8 RCAACRFLRRRCPQDCVLAPYFPSSNPERFACVHKIFGAGNITKMLEQLPVHLREAAADSMFYEASLRVEDPVYGCVRIISQLQHHILEAQSEILK 103
                    6*******************************************************************************************9988 PP

         DUF260  97 lkee 100
                    ++ +
  MDP0000121821 104 TNGQ 107
                    7765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7177108IPR004883Lateral organ boundaries, LOB
PfamPF031957.4E-408103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MISNNPTRCA ACRFLRRRCP QDCVLAPYFP SSNPERFACV HKIFGAGNIT KMLEQLPVHL  60
REAAADSMFY EASLRVEDPV YGCVRIISQL QHHILEAQSE ILKTNGQIAS YIAQQQLHQQ  120
QQNVVHGASY QQDMQISEYS GVGWDVQTLA NDSYFHT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-34911112114LOB family transfactor Ramosa2.1
5ly0_B1e-34911112114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008380285.11e-116LOB domain-containing protein 24-like
SwissprotP594684e-46LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A498HEA63e-85A0A498HEA6_MALDO; Uncharacterized protein
STRINGXP_008380285.11e-115(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-36LOB domain-containing protein 24