PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000121203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 230aa    MW: 25207.9 Da    PI: 8.9467
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000121203genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.95.5e-46701691100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal
  MDP0000121203  70 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLAL 165
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MDP0000121203 166 AQAE 169
                    9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0469170IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4570167IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MKIREQTIHL HSMLPNEKKA SSFSFKEKLC YPTQLGLLPT VGDCVRPTKI RHAASMKENG  60
GSRKQGAPSP CAACKLLRRR CAQDCVFAPY FPADEPQKFA NVHKVFGASN VNKMLQELPE  120
HQRGDAVSSM VYEANARVRD PVYGCVGAIS SLQQQIDVLQ TQLALAQAEV VHLRVRQTAS  180
FSSHGLSPAS PSNSGSPPSK FMGSQTRPVF DMDMMVDHTS LGLGESMWSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-49661717112LOB family transfactor Ramosa2.1
5ly0_B2e-49661717112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.114620.0cell culture| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383342.11e-128LOB domain-containing protein 4
SwissprotQ9SHE93e-78LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A498IXM71e-152A0A498IXM7_MALDO; Uncharacterized protein
STRINGXP_008383342.11e-128(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-80LOB domain-containing protein 4