PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000120802
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 439aa    MW: 48304.4 Da    PI: 6.3563
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000120802genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.82.3e-08332389562
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                    kr++r   N  +A rs +RK  +i eL++kv++Le+e   L  +l  lk   ++ ++e
  MDP0000120802 332 KRAKRILANSQSAVRSKERKMRYISELKQKVQTLETEVAILNAQLTLLKGDFDSIRNE 389
                    9*********************************************999887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.4E-12328392IPR004827Basic-leucine zipper domain
PfamPF077167.1E-7329380IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.99330393IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-7332385No hitNo description
SuperFamilySSF579591.31E-8332382No hitNo description
CDDcd147031.09E-19333380No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MGIPPSSSSS SHSHHILPIS PCSEIMVSQP TVFSLDSLHP LTPSQYRNSS SSASMQNGDV  60
GACSLLSPSH LTKENYLRTG ECLSPCNAHR RSNSDIPFGF SSLMQQSFPP IAPIRGLGGL  120
ELSMSGAENL GLVKPAQLVQ KKSSLQRVSD NNVVGELVDD LFLIYMNSDN IDVLNSLGTD  180
DKNEHENCEE LGRASGIKTG DNSVTEAESN VNESGGSIRK LGLNIFNDKR EVIRRSAWGD  240
IAPTSRHRRS VSMDCFKGKL QFGDELHRLP PSLGTPPGQV SPSNSTGAPS NSIDANLNAF  300
SSEFRYVEFS EAEMKNIMAN EKLSGVALTD PKRAKRILAN SQSAVRSKER KMRYISELKQ  360
KVQTLETEVA ILNAQLTLLK GDFDSIRNET NELKFRLQAM EQQEQLLDGM YHECIRLMVQ  420
NSKVFSSSDV IFEKECIYV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028959233.10.0uncharacterized protein LOC114825066
TrEMBLA0A498JUL50.0A0A498JUL5_MALDO; Uncharacterized protein (Fragment)
STRINGXP_004290316.11e-163(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-101bZIP family protein