PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP04680_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 585aa    MW: 62377.6 Da    PI: 7.131
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP04680_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS338.89.4e-1042065852374
                           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                    ++ Ll+ A a+++g+le a+a La l+  a+++gd+ qRl+a+++ AL +rl+   +  + +lp  +     s e++aa 
  GSMUA_AchrUn_randomP04680_001 206 RQMLLDTAAAIADGNLETATANLAVLNRVANSRGDAEQRLTAMMVGALLSRLNP-AQAGSTSLPIAALC---SGEHFAAA 281
                                    689**************************************************9.44445556777776...999***** PP

                           GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.....egppslRiTgvgspesg... 153
                                    ++++e+sP++k++ ++aN aIlea++ ++++Hi+Df+++qG+Q++aLl+ La+R        pp lRiT+v++p+     
  GSMUA_AchrUn_randomP04680_001 282 QMLYELSPCFKLGLVAANLAILEATKDQSMIHILDFSLGQGGQYAALLHVLAERHrfqpaVCPPALRITVVADPSFPftn 361
                                    ******************************************************977544459**********9865788 PP

                           GRAS 154 ..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklv 231
                                      s+ +l+++g+r++k+Ae+ g++++f+v v++r ++l+ ++L ++pgEalaVnl+++l r++desvs +++rde+L+ v
  GSMUA_AchrUn_randomP04680_001 362 pnSSGNLRAVGDRIEKLAERAGLEVRFSV-VHRRAAELDASTLGCQPGEALAVNLAFALSRVPDESVSPANPRDELLRRV 440
                                    9999************************9.7************************************************* PP

                           GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhet 311
                                    + l+P+vv +veq+++++++ F+ rf+ea+ +y al++sl+a++ r+s er+ vE+  l+r++vn va eg +r+er+e 
  GSMUA_AchrUn_randomP04680_001 441 RALRPRVVALVEQDINTSTAAFAGRFAEACAHYGALLESLDATVNRDSAERARVEAG-LARRAVNSVAREGMDRVERCEV 519
                                    *********************************************************.9999****************** PP

                           GRAS 312 lekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv..lgWkdrpLvsvSaWr 374
                                    ++kWr+r+++aGF++vpl+ ++ + +k+ l+ v+ ++g+++ ee g     +gWk+r+++++SaWr
  GSMUA_AchrUn_randomP04680_001 520 FGKWRARMRMAGFESVPLGRDVIEPVKARLASVApDHGFTIREETGGHGlgFGWKGRAITVASAWR 585
                                    ******************************************9855432259*************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.897179562IPR005202Transcription factor GRAS
PfamPF035143.3E-101206585IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MASGFPVREL GFGVQIPMPT RAEAGSGGLL KRSLTEMERQ RQQQQMQMQN AHFLRSVRQR  60
TLLAPHASSH LSPPLLPVVL SSGSSSSVSA NLTASGFARP QEHSSVPQAA GTGVERMRDR  120
LQELERRLLL DEEEEEEEGE VSASSSAVTT AEWSDAMQQI ITPQAPVPTP LSSSPTSSSS  180
STVSSSVSCS PPSTSTATVA AASSSRQMLL DTAAAIADGN LETATANLAV LNRVANSRGD  240
AEQRLTAMMV GALLSRLNPA QAGSTSLPIA ALCSGEHFAA AQMLYELSPC FKLGLVAANL  300
AILEATKDQS MIHILDFSLG QGGQYAALLH VLAERHRFQP AVCPPALRIT VVADPSFPFT  360
NPNSSGNLRA VGDRIEKLAE RAGLEVRFSV VHRRAAELDA STLGCQPGEA LAVNLAFALS  420
RVPDESVSPA NPRDELLRRV RALRPRVVAL VEQDINTSTA AFAGRFAEAC AHYGALLESL  480
DATVNRDSAE RARVEAGLAR RAVNSVAREG MDRVERCEVF GKWRARMRMA GFESVPLGRD  540
VIEPVKARLA SVAPDHGFTI REETGGHGLG FGWKGRAITV ASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4522458522375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009385927.10.0PREDICTED: scarecrow-like protein 8
TrEMBLM0U6D00.0M0U6D0_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP04680_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-98SCARECROW-like 8