PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP00680_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 399aa    MW: 43302.9 Da    PI: 6.9152
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP00680_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.3e-10201259563
                                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                    kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+     l++e+
  GSMUA_AchrUn_randomP00680_001 201 KRTKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTMLQRDTNGLTAEN 259
                                    9**********************************************999888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-17197261IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139199262IPR004827Basic-leucine zipper domain
PfamPF001707.1E-9201256IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.8E-11201255No hitNo description
SuperFamilySSF579595.42E-11201252No hitNo description
CDDcd147032.37E-23202251No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MDKDKSPAPG GGGGGGSGRG LPPHLPRYSP FGSPSSSFSF MGDLSASSSS QPSSNSGHFA  60
YETPSDARRF SYDVSRMPDF PQRNAGHRRA HSEILGLPDD ICFDSDLGVV GSHGGPSLSD  120
EAEEDLVSMY IDVEKFSSGA TSAALSIGEP RIRHQHSQSL DGSTAIKSEF LLSGGEGPLS  180
AEAKKAMSAA KLAELALVDP KRTKRILANR QSAARSKERK MRYIAELERK VQTLQTEATT  240
LSAQLTMLQR DTNGLTAENN ELKLRLQTME QQVHLQDALN EALREEVQHL KLATGQMLPN  300
GGQSTNTIPP SLGANHQFYH QNQAMHSLLA AHQFQQLQIH SQHPQQLQPS HQIQPPSSLQ  360
HLHTLQPQQQ PPADLRMKGS STSQNQRGEA TSDNNSAQE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009385451.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_009385452.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_018676687.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_018676688.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ040881e-127POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0U5800.0M0U580_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP00680_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-118bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]