PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P21470_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family RAV
Protein Properties Length: 310aa    MW: 35290.7 Da    PI: 10.3512
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P21470_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP236.31.4e-11781171055
                    AP2  10 kkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                            + +grW A+I++      ++r++lg+f t+ eAa+a++ a ++++g
  GSMUA_Achr9P21470_001  78 P-NGRWGAQIYEK-----HQRVWLGTFNTEAEAARAYDVAVRRFRG 117
                            4.7*********3.....5**********99************998 PP

2B369.93.4e-221762481790
                            E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                     B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                            + p + a++ g  + +++ l +ed  gr+W+++++y+++s++yvltkGW++Fvk++gL++gD+v F+++   e+
  GSMUA_Achr9P21470_001 176 TAPSRGAAAGG-GPSNGMLLNFEDACGRVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLEAGDVVSFQRSTGPEK 248
                            55666664444.457889*************************************************7654444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF541713.79E-1669125IPR016177DNA-binding domain
CDDcd000182.08E-2269124No hitNo description
PROSITE profilePS5103219.83670125IPR001471AP2/ERF domain
SMARTSM003805.3E-2770131IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.105.2E-1970125IPR001471AP2/ERF domain
PfamPF008477.8E-777117IPR001471AP2/ERF domain
SMARTSM010192.3E-5149256IPR003340B3 DNA binding domain
PfamPF023627.2E-19180246IPR003340B3 DNA binding domain
CDDcd100171.32E-15186243No hitNo description
SuperFamilySSF1019363.66E-19187252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.8E-23189258IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.787194256IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MRSPISYITP PFELVIEPLP NLFFRTFVHI FATSVQTDLF TRRDMETSSI GDAWGESGKR  60
DESRKLPSSR YKGAVPQPNG RWGAQIYEKH QRVWLGTFNT EAEAARAYDV AVRRFRGRDG  120
VTNFKPLNES DDDDAAELSF IGSRSKVEIV DMLRRHSYHH ELQQSRRSFG ADKMKTAPSR  180
GAAAGGGPSN GMLLNFEDAC GRVWRFRYSY WNSSQSYVLT KGWSRFVKEK GLEAGDVVSF  240
QRSTGPEKQL FIDSKARAGR GHTAVPMPRP PVQHFRLFGV NIARNPATHR DDMEFISSQD  300
MFKRQRTEAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A9e-3119125951119DNA-binding protein RAV1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences. Functionally redundant with TEM2. {ECO:0000269|PubMed:18718758}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn. {ECO:0000269|PubMed:18718758}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418388.20.0PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like
SwissprotQ9C6M55e-86RAVL1_ARATH; AP2/ERF and B3 domain-containing transcription repressor TEM1
TrEMBLM0U2A60.0M0U2A6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P21470_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45638203
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13260.19e-87related to ABI3/VP1 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Choi D, et al.
    iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis.
    Mol Plant, 2014. 7(5): p. 792-813
    [PMID:24380880]
  3. Sgamma T,Jackson A,Muleo R,Thomas B,Massiah A
    TEMPRANILLO is a regulator of juvenility in plants.
    Sci Rep, 2014. 4: p. 3704
    [PMID:24424565]
  4. Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S
    RAV genes: regulation of floral induction and beyond.
    Ann. Bot., 2014. 114(7): p. 1459-70
    [PMID:24812253]
  5. Marín-González E, et al.
    SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
    Plant Physiol., 2015. 169(2): p. 1214-24
    [PMID:26243615]
  6. Matías-Hernández L, et al.
    TEMPRANILLO Reveals the Mesophyll as Crucial for Epidermal Trichome Formation.
    Plant Physiol., 2016. 170(3): p. 1624-39
    [PMID:26802039]