PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P10600_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family CPP
Protein Properties Length: 738aa    MW: 81110.7 Da    PI: 6.6701
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P10600_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.71.7e-16425462340
                    TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            +k+CnCkkskClk+YCeCfaag++Cse C+C++C+Nk 
  GSMUA_Achr9P10600_001 425 CKRCNCKKSKCLKLYCECFAAGVYCSEPCSCQGCFNKP 462
                            89**********************************96 PP

2TCR50.34.7e-16509547139
                    TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                            ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  GSMUA_Achr9P10600_001 509 RHKRGCNCKKSNCLKKYCECYQGGVGCSISCRCEGCKNL 547
                            589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-18423464IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.195424549IPR005172CRC domain
PfamPF036384.5E-12426461IPR005172CRC domain
SMARTSM011141.5E-16509550IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.6E-11511546IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MLQESPIFNF INNLSPIQPV KSIDSVHIAH TYQSLNFASL SSIFSSPHAN PPRETRVLSR  60
PPFTDTTKQE NFASNVGESN LCSEVSDAVR PSRFTASTRG NYTTCSLNEA ALDPSDQCPS  120
LHSPFPQSTQ YNSGSPDHNM PTHFGIKMDP NLDIGHTPVE IHLVQNGGER RKILFAMEAG  180
FQGNHPHELN KDEVVGCDWE SLISDDVESL LIFDSSTESE AHNEVGEKGM DCDGNSLVSV  240
LSNCTENADH QQATQPDISL GAFVHNVNQD PSLNSNEDSR KENETDHATN LLSGTCQAQN  300
LHLKHTYLVD CHQKRGMHRR CLVFERICDG NNLEPKISRS LCALSGIGLH LNTLATTSKD  360
RMDNSLRKPF SAEKDLRPSG SELDPQIISY DAPKDGKPNN SEELNQGSPK KKRRKSENGG  420
ESEGCKRCNC KKSKCLKLYC ECFAAGVYCS EPCSCQGCFN KPIHEETVLA TRKQIESRNP  480
LAFAPKVIRT SDSGLDMGDD DKKTPASARH KRGCNCKKSN CLKKYCECYQ GGVGCSISCR  540
CEGCKNLYGR KDGILPGVEE IEQVEKEPDV CEKENESSDD VQLHHATNVQ VDEHHTYGEV  600
LPITPYQHCR LSVELPFSSS AKPTRPTKLS IGRSPGLYGF HMLQKSEIIL PQPKFENKGS  660
TVLEDDTPAI LKPIASPTMG VNISSPNRKR VSPPHNGGVG SSPPNRKGCR KLILKSIPSF  720
PSLTGDASTE SPVNYSNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1742654712121Protein lin-54 homolog
5fd3_B1e-1742654712121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1409413KKKRR
2409414KKKRRK
3410414KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009417099.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X3
TrEMBLM0TZ690.0M0TZ69_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P10600_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-121TESMIN/TSO1-like CXC 2