PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P10150_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 466aa    MW: 53832.3 Da    PI: 8.621
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P10150_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81e-07171215246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             +WT  Ed++l+  v+q G  +W  I+  +g++Rt+ qc +r+q 
  GSMUA_Achr9P10150_001 171 SPWTVMEDKKLLFIVQQRGIYNWIDISILLGTHRTPFQCLLRYQR 215
                            58*****************************************96 PP

2Myb_DNA-binding43.29.3e-14223269148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            ++ WT+e+d +l  av+ +G + W  Ia+++  gRt+ qc +rw k l
  GSMUA_Achr9P10150_001 223 KKEWTEEDDVKLSAAVENYGDNKWQFIASCLE-GRTGPQCSNRWKKTL 269
                            679*****************************.***********9975 PP

3Myb_DNA-binding47.44.4e-15277321247
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            grW+ +Ed++l+ av ++G ++W++Ia   + gRt  qc++rw++ 
  GSMUA_Achr9P10150_001 277 GRWSVDEDKQLKVAVMLFGAKNWNKIAWFAP-GRTQVQCRERWLNC 321
                            8******************************.***********996 PP

4Myb_DNA-binding54.82.1e-17330370345
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            +WT+eEd +l+da++ +G+  W++Ia++++  Rt++qc+ rw 
  GSMUA_Achr9P10150_001 330 PWTAEEDAKLLDAIAVHGNC-WSKIAACIP-PRTDNQCRRRWK 370
                            8*****************99.*********.9**********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.1172166IPR001005SANT/Myb domain
PROSITE profilePS500905.72673162IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.0E-87491IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-8136173IPR009057Homeodomain-like
SuperFamilySSF466894.92E-12162220IPR009057Homeodomain-like
PROSITE profilePS500908.211165217IPR017877Myb-like domain
SMARTSM007174.7E-4169219IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-13174224IPR009057Homeodomain-like
SuperFamilySSF466896.58E-21203274IPR009057Homeodomain-like
PROSITE profilePS5129420.823218273IPR017930Myb domain
SMARTSM007174.1E-13222271IPR001005SANT/Myb domain
CDDcd001678.79E-11225269No hitNo description
Gene3DG3DSA:1.10.10.606.2E-17225272IPR009057Homeodomain-like
PfamPF139211.5E-11226275No hitNo description
Gene3DG3DSA:1.10.10.603.8E-17273322IPR009057Homeodomain-like
SuperFamilySSF466893.08E-30273369IPR009057Homeodomain-like
PROSITE profilePS5129411.568274322IPR017930Myb domain
SMARTSM007178.6E-13275324IPR001005SANT/Myb domain
PfamPF002494.4E-14277321IPR001005SANT/Myb domain
CDDcd001678.71E-11278320No hitNo description
PROSITE profilePS5129422.598323377IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-21323374IPR009057Homeodomain-like
SMARTSM007171.0E-16327375IPR001005SANT/Myb domain
PfamPF002491.4E-15329370IPR001005SANT/Myb domain
CDDcd001676.37E-14330373No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MQSVLSLVTS LFFYIIIGFV EFNRTQCPLA KRAFGYLQTT LKKLPALHFG PGENSHILRC  60
RMVLERFPVS LCKQPWSKTE KENLAKGIKQ QYQEMLILNS MNMESDEEGI TDSSIMSATT  120
LSDLEFTPEK IRSFMPLVNW NRLASMYVMG RSGTECEARW LNCEDPMINH SPWTVMEDKK  180
LLFIVQQRGI YNWIDISILL GTHRTPFQCL LRYQRSLNPH ILKKEWTEED DVKLSAAVEN  240
YGDNKWQFIA SCLEGRTGPQ CSNRWKKTLN PERKKVGRWS VDEDKQLKVA VMLFGAKNWN  300
KIAWFAPGRT QVQCRERWLN CLDPALNLNP WTAEEDAKLL DAIAVHGNCW SKIAACIPPR  360
TDNQCRRRWK ILLPEEVKLL QAAAQIKKTA LISNFVDRES ERPAIGPNDF TSIVNSTISE  420
KTDYVEARKK KLRYYSLDIH KYSLNFVAIP LCLVLDHILL SLDDFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-321213783159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-321213783159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009416755.10.0PREDICTED: uncharacterized protein LOC103997311 isoform X1
RefseqXP_009416756.10.0PREDICTED: uncharacterized protein LOC103997311 isoform X2
TrEMBLM0TZ240.0M0TZ24_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P10150_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-146myb domain protein 4r1