PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P04290_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Dof
Protein Properties Length: 291aa    MW: 31553.2 Da    PI: 6.3378
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P04290_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.2e-403899263
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                           +e+++kcprC+stntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvP+Ggg+rknkksss
  GSMUA_Achr9P04290_001 38 PEQSIKCPRCESTNTKFCYYNNYSLAQPRYFCKGCRRYWTKGGTLRNVPIGGGCRKNKKSSS 99
                           7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-263692IPR003851Zinc finger, Dof-type
PfamPF027012.3E-334096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9014296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MKVSSANHQV AMASFPLEEV LGGLTKAEQQ EGKVRPQPEQ SIKCPRCEST NTKFCYYNNY  60
SLAQPRYFCK GCRRYWTKGG TLRNVPIGGG CRKNKKSSSS KRPQDQSFHA NPITSLASSS  120
ALPPFLAYDP NDLILAFAKL QEAHRNPGHL LDDHETALHG DSIPEPGRVP DGLGEPAEFL  180
DFLNTRTTDP TGFHNLHCGY SGIGDVYQGL GLPFDAGLGG ETTSSTAAAA TTVTANQVCC  240
KVLNGSEDDT MSMGMQWQVA EDLNMASDSG RDHQWNEVGS AWHGLINSSL L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009416705.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLM0TXD80.0M0TXD8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P04290_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-34TARGET OF MONOPTEROS 6