PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P30770_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family G2-like
Protein Properties Length: 355aa    MW: 38717.7 Da    PI: 6.5693
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P30770_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.1e-32184237255
                G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            pr+rWt+ LH+rFv+ave LGG+e+AtPk+ilelm+vk+Ltl+hvkSHLQ+YR+
  GSMUA_Achr8P30770_001 184 PRMRWTSSLHTRFVRAVELLGGHERATPKSILELMDVKDLTLAHVKSHLQMYRT 237
                            9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.91E-16181238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-29181238IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-24184238IPR006447Myb domain, plants
PfamPF002491.6E-7185236IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MSSQGVFTEA SSTASPDLSL QIGPPSIAPS AISDAGSGSR ACVDLSLSST MSSSEGNIFQ  60
GFRGPPPFHE SIIPLTGTPT YVDGRSPFNQ MSSSSLSSSS SSTGCWSAIY STASYLHPHN  120
GSHSSVSSYT WTPPLPTWIM GSSSDSFSCY HRLPCGVGSW EASQNLMRSR FLPRYPTKRS  180
TRAPRMRWTS SLHTRFVRAV ELLGGHERAT PKSILELMDV KDLTLAHVKS HLQMYRTIKS  240
TDKPAASSGQ SDDSGEEDSA PRDRDQPLLM EHKVSDPPKQ DHCLETSSGI SREDWLPINS  300
NYLDSTGLRS APLSSQIEHD SSGSNGTNDS YEEHRIPSLE FSLGRSDWYD KRPLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-17185239357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-17185239357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-17185239357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-17185239357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-17185239458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009414795.10.0PREDICTED: transcription repressor KAN1-like isoform X1
TrEMBLM0TV290.0M0TV29_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P30770_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-45G2-like family protein