PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P30640_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRF
Protein Properties Length: 320aa    MW: 35577.4 Da    PI: 8.0102
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P30640_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC794.6e-2578121144
                    WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                            d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg+srsrk++e
  GSMUA_Achr8P30640_001  78 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKSRSRKPVE 121
                            79***************************************997 PP

2QLQ52.81.2e-181044236
                    QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                           +FTa+Q+q+L+ Q+l++Ky++++ PvP++L++ i+
  GSMUA_Achr8P30640_001 10 PFTASQWQELELQALVFKYMVSGIPVPSDLILCIR 44
                           9******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-9945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.8141045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-131043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.94178122IPR014977WRC domain
PfamPF088791.9E-2079121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MMMGGGSRYP FTASQWQELE LQALVFKYMV SGIPVPSDLI LCIRRSLFMD PQALPFIPNP  60
PTIGWGAYQL GDGRKPVDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH RGKSRSRKPV  120
ELSLATNPTS SQFSSSNFVA AAAAAAAAAP PPPPPPPLSL STPQTHHFLL PCPSSSRPPA  180
MGFSLKDDSA SFCLDSSPYT VDNYRLGSMD MSSVEETKQS FGYMQGAHPH SRICLSEEQD  240
KEKHYFVLGA DLKTDKSAKL ERAEQPQNAR PFHCFLDEKP QKMEDSWMSM DADLKMQLSI  300
SIPMANHDKP VAASQRYNDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009414811.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLM0TV160.0M0TV16_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P30640_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-49growth-regulating factor 5