PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P22900_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family G2-like
Protein Properties Length: 377aa    MW: 41428.2 Da    PI: 7.596
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P22900_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32212265255
                G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GSMUA_Achr8P22900_001 212 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 265
                            9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15209266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28210265IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-24212265IPR006447Myb domain, plants
PfamPF002496.5E-7213264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MEAASAPSPD LSLHISLPNT APSVSGGGIA IDQGNSTIEL RQAGGGGNNA YTELSLSYPW  60
AAPQAESSWQ QRMLSVRQSP PFDHCCRNRS TLDGLMEGSR PIKGIPVYNN SAFPFLPLDP  120
KYGFSSNLDM MPSSLLNPVG GVSAYTRMVT PPTRFNGFSP DLLIKNHYQH HQLFQHPHHQ  180
HHYGTRPFDS SHNLMRSRFL PKLPGKRSMR APRMRWTSTL HARFVHAVEL LGGHERATPK  240
SVLELMDVKD LTLAHVKSHL QMYRTLKTTD KPAASSGQSD GSGEEDSAPS NDDLNFGRLG  300
EQRVSSADGL KPSHGLDSLS SITNTAASFS RDAWAQPSAG DIDELRPSEF SSDTEELKNP  360
SLEFTLGRPD WQGRKHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-16213267357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16213267357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16213267357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16213267357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009414091.10.0PREDICTED: transcription repressor KAN1 isoform X1
TrEMBLM0TSU30.0M0TSU3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P22900_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-56G2-like family protein