PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P20460_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family CPP
Protein Properties Length: 805aa    MW: 87974.8 Da    PI: 6.6922
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P20460_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.91.5e-16486523340
                    TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            +k+CnCkkskClk+YCeCfaag++Cse C+C++C+Nk 
  GSMUA_Achr8P20460_001 486 CKRCNCKKSKCLKLYCECFAAGVYCSEPCSCQGCFNKP 523
                            79**********************************96 PP

2TCR50.63.9e-16570608139
                    TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                            ++k+gCnCkks+ClkkYCeC++ g+ Cs  C+Ce+CkN 
  GSMUA_Achr8P20460_001 570 RHKRGCNCKKSNCLKKYCECYQGGVGCSIGCRCEGCKNL 608
                            589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.5E-18484525IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.017485610IPR005172CRC domain
PfamPF036385.0E-12487522IPR005172CRC domain
SMARTSM011141.1E-16570611IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.7E-11572607IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 805 aa     Download sequence    Send to blast
MDTPERAKIA GTPLSKFEDS PIYNFINNLS PIQPVKSIDS VPIAHTHQPL NFASLSSIFS  60
SPHDNPPRET RFLTRHPFTD YFKQENFSDN VGESSLCPEV SDAGRPSGFT SSSQENCTMT  120
CSLNEATVDP PDECPALPST FPQSTQYYSG SPDHNVEPCL GIKMDLKLDV GHTPVEFHFV  180
QNGVERRKVL FAMEDGVQEN LPLELNKDKG VGCVWESLIP DDGQSLLIFD SSTESEAHKG  240
VSEKAVDNDG HSIVSLLSNC TENADHLQKT KPDISHGPCV HNVNQDPSQN CSKVFEKEDE  300
TDHATKMLSD MCHDQVDSHQ QRGMRRRCLV FEVASVSKRN MYSDSKLNPL TSLSFKGKSV  360
CDTKNLKPEI RESLYALPGI GLHLNALATT SKDRMVNKET LASEKQIISN PCSVGSLTST  420
TAGRNSLRKS SAVEKDLCPS GSEVDLQIVS DDAPKDATPN ICEELSQGSP KKKRRKSGNG  480
GESDGCKRCN CKKSKCLKLY CECFAAGVYC SEPCSCQGCF NKPIHEETVL ATRRQIESRN  540
PLAFAPKVIR TSESGLEMGD DDKKTPASAR HKRGCNCKKS NCLKKYCECY QGGVGCSIGC  600
RCEGCKNLFG RKDGFLPRFE ELEQAEKEAN ACEKENESPG DDQQNTSIQI DEHHSSGHIL  660
PITPYQSCRL SVELPFSSIA SSTTSTKLSI GRSPALYGSH MLRKCEMVLP PPKLENNVST  720
VVEDDTPAIL RPTVSPTTTG IRIASPNQKR VSPPHGGVGL SPPSRKGCRK LILRSIPSFP  780
PLGSDVSAEH PVNYSNSSFG SSTVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1748960814121Protein lin-54 homolog
5fd3_B1e-1748960814121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1470474KKKRR
2470475KKKRRK
3471475KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009413895.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
RefseqXP_009413896.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLM0TS490.0M0TS49_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P20460_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-124TESMIN/TSO1-like CXC 2