PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P05850_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 650aa    MW: 71598.6 Da    PI: 6.3345
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P05850_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS407.99.7e-1252686351373
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            lv+lL++cAe +s+g+ e+ + +Larl e+a+p+g+p++R++ay+teALa r+ar  +++++  pp++  + ++++++ al+l+  vs
  GSMUA_Achr7P05850_001 268 LVRLLTSCAESISTGNYEAMNFFLARLGEMATPQGTPIHRVVAYYTEALALRVARLRPHMFSVAPPRSLLDPTEDDNAIALRLLDCVS 355
                            6899*****************************************************************9999*************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvp 175
                            Pi+kf h+t N+ +l+a+eg +rvHiiDf+i+qGlQWp+L+q+LasR+ ++p ++RiTgvg+    s++ l+ tg rLa++Ae++++ 
  GSMUA_Achr7P05850_001 356 PIPKFLHFTLNERLLKALEGRDRVHIIDFNIKQGLQWPSLFQSLASRRpNPPSHVRITGVGE----SRQDLQDTGIRLARLAESFNLA 439
                            *********************************************87747777*********....9********************* PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                            fef++ v++rled++l++L+vk++E+laVn+vl +h+ l ++   +    ++L+l++s+ P++vv++eqea+hn++++ +r++++l+y
  GSMUA_Achr7P05850_001 440 FEFHA-VVDRLEDVRLWMLHVKREECLAVNCVLTMHKALYDESGKA--FMDLLDLIRSTHPEIVVMAEQEAKHNEPNWETRLARSLSY 524
                            *****.7******************************985554444..479************************************* PP

                   GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                            y+a+fds++  lp++s++rikvE++ +++ei+n+vaceg+er+erhe++  W++ +e+ GF+ + ++e+++ q +++lr+++ + y++
  GSMUA_Achr7P05850_001 525 YAAIFDSMDDALPKDSQARIKVEEV-FAKEIRNIVACEGDERTERHESFDGWSKLMEDGGFRCLGIGEREMLQSRMILRMYSCEKYSI 611
                            ************************9.********************************************************888*** PP

                   GRAS 352 eee..sgslvlgWkdrpLvsvSaW 373
                            e++   + l+l+W d+pL++vSaW
  GSMUA_Achr7P05850_001 612 EKQgeGDGLTLMWLDQPLYTVSAW 635
                            *875477899************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.692242614IPR005202Transcription factor GRAS
PfamPF035143.4E-122268635IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MLAGCSSTLL SPRHKLRIDA SVQLQACHFQ LQEKHCPPQQ QKMGTQRLDL PCGFASRKDP  60
LRVALSVEKP AAEARGTSCS FRRNPVTHSS SSSMVARTSS WGGTGEIDGG HGGPWERRRS  120
SKRFHERGSC DDYRAKRTRT GGIAGLVDVE GEVWLPQSTQ EPPLVEGEKV FLVPTAASFP  180
LPSSSSHTLV GGSSGPDNDL STGENPNGKS QSDSSSSSSS AYVSSPEPTK DSSGNTASNG  240
SRIPCSSGVA DAGGDGDGSL TEQQGLELVR LLTSCAESIS TGNYEAMNFF LARLGEMATP  300
QGTPIHRVVA YYTEALALRV ARLRPHMFSV APPRSLLDPT EDDNAIALRL LDCVSPIPKF  360
LHFTLNERLL KALEGRDRVH IIDFNIKQGL QWPSLFQSLA SRRPNPPSHV RITGVGESRQ  420
DLQDTGIRLA RLAESFNLAF EFHAVVDRLE DVRLWMLHVK REECLAVNCV LTMHKALYDE  480
SGKAFMDLLD LIRSTHPEIV VMAEQEAKHN EPNWETRLAR SLSYYAAIFD SMDDALPKDS  540
QARIKVEEVF AKEIRNIVAC EGDERTERHE SFDGWSKLME DGGFRCLGIG EREMLQSRMI  600
LRMYSCEKYS IEKQGEGDGL TLMWLDQPLY TVSAWAPRDV AGSSSMSQPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4529163526374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009407962.10.0PREDICTED: scarecrow-like protein 28 isoform X1
TrEMBLM0TF250.0M0TF25_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P05850_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-160GRAS family protein