PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P02680_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 294aa    MW: 31021.7 Da    PI: 9.0164
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P02680_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP121.97.1e-3872143273
                    TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                            a+++++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+p+i+++tgt++++a ++
  GSMUA_Achr7P02680_001  72 APRRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEPSIIAATGTGTIPAAAA 143
                            7899************************************************************99999444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.6E-3177145IPR005333Transcription factor, TCP
PROSITE profilePS5136927.99278132IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDRKSCAKLP RDVPKFQQTL CLPQGDKKEP TTAADSVASA ERRDLLPSAA LGGRELQVAA  60
AREKDEQRRQ LAPRRSSNKD RHTKVDGRGR RIRMPALCAA RIFQLTRELG HKSDGETVQW  120
LLQQAEPSII AATGTGTIPA AAAAVQPNWA AVGAAGLPRS HPGLWPTPVC GFDSGFMRPS  180
AAASSSSNNV GAGGGDASIG SFVQRTGLHG LELAGSNLSA MSFASMLGGH GQQLPGLELG  240
LSQDGRIGVW NLEAMGQIYQ QMEPGRLVAG ANGAGQWQQQ QTHQSDDSSQ GSEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408353.10.0PREDICTED: transcription factor TCP20-like
TrEMBLM0TE580.0M0TE58_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P02680_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.14e-35TCP family protein