PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P02330_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRF
Protein Properties Length: 344aa    MW: 39297.5 Da    PI: 9.8577
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P02330_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.41.4e-2481124144
                    WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                            d+epgrCrRtDGKkWRCs+++ +g+k+CE+H+hrg++rsrk++e
  GSMUA_Achr7P02330_001  81 DTEPGRCRRTDGKKWRCSKEAFPGSKYCEKHMHRGKNRSRKPVE 124
                            689**************************************998 PP

2QLQ35.72.6e-13935228
                    QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvP 28
                           +FT++Q+q+L++Q l y+y++++ P P
  GSMUA_Achr7P02330_001  9 PFTPSQWQELEQQRLFYRYMVSGIPNP 35
                           9**********************9966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.2E-5844IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166614.896944IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.6E-8933IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.20581125IPR014977WRC domain
PfamPF088791.6E-2083124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MSGISSSYPF TPSQWQELEQ QRLFYRYMVS GIPNPWDLSL RIRRSFLLEP TTMISPTVAY  60
PPHLHLCWGR VRLGVGREGE DTEPGRCRRT DGKKWRCSKE AFPGSKYCEK HMHRGKNRSR  120
KPVEMSLADN LSTTAQPPSS FSSSTTTKSS TSNTPCHHHP YHLPVPAPEV SSFLTCPSSK  180
SQHNTPTYNS ADIAYRKNSS RFRPLGMNSL VGKGHMAFVP QQSTSSHSRI DLPREEKPQH  240
CFVLGTDLKL EKPATVESKQ KPLLHFLDER PTTSNTLCLD SKADHSKTQL SISIPVAYHD  300
FPAFKSGFNR ERYRTSSVTF KLCINCDHYE LRLELIRRYS FWSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408407.10.0PREDICTED: growth-regulating factor 1 isoform X1
TrEMBLM0TE230.0M0TE23_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P02330_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-36growth-regulating factor 5