PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P31410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 593aa    MW: 68666.5 Da    PI: 9.8653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P31410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.22.8e-11341384348
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             WT++Ed +l  av+ +G + W  +a+++  gR + qc +rw+k l
  GSMUA_Achr6P31410_001 341 DWTEDEDAKLRVAVEYYGDN-WQMVASCLE-GRVGPQCSNRWNKTL 384
                            6*****************77.*********.************975 PP

2Myb_DNA-binding48.52.1e-15392436247
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            grW+ +Ed++l+ av ++G ++W++Ia   + gRt  qc++rw++ 
  GSMUA_Achr6P31410_001 392 GRWSVDEDKRLKVAVMLFGAKNWNKIAWFAP-GRTQVQCRERWHNC 436
                            8******************************.************96 PP

3Myb_DNA-binding52.61.1e-16445485345
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            +WT+eEd +l+da +++G+  W++Ia++++  Rt++qc+ rw 
  GSMUA_Achr6P31410_001 445 PWTAEEDAKLLDARAMHGNC-WSKIAACIP-PRTDNQCRRRWK 485
                            8*****************99.*********.9**********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.424184278IPR017877Myb-like domain
SMARTSM007172.6188282IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-8190207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-8252293IPR009057Homeodomain-like
PROSITE profilePS500907.921281333IPR017877Myb-like domain
SuperFamilySSF466898.81E-22285380IPR009057Homeodomain-like
SMARTSM007170.047285335IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-11294339IPR009057Homeodomain-like
PROSITE profilePS5129416.494334388IPR017930Myb domain
SMARTSM007179.4E-9338386IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-15340386IPR009057Homeodomain-like
PfamPF139212.0E-9342390No hitNo description
CDDcd001671.17E-6342384No hitNo description
Gene3DG3DSA:1.10.10.601.9E-17387437IPR009057Homeodomain-like
SuperFamilySSF466896.97E-30388484IPR009057Homeodomain-like
PROSITE profilePS5129412.82389437IPR017930Myb domain
SMARTSM007171.5E-12390439IPR001005SANT/Myb domain
PfamPF002495.9E-14392436IPR001005SANT/Myb domain
CDDcd001674.44E-10393435No hitNo description
PROSITE profilePS5129421.648438492IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-20438488IPR009057Homeodomain-like
SMARTSM007174.2E-16442490IPR001005SANT/Myb domain
PfamPF002493.7E-15445485IPR001005SANT/Myb domain
CDDcd001676.32E-13445488No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MSWTIHGWVR IVASCGIFLL DKATTWCRLG TKTPNRSTEL SKEHGYSHTE PHFPEHEAWS  60
SNVKDLTSSK FPKSAHNFVN ALKKNRSCQK FIRRKLLEIE AKIEKNKELK ERIKCLMDFQ  120
VACKRKVANI LYQKKDPRIT LISLKRSTSE KSSKTTLKKV PASYIGPNEN SHVSKYKMVL  180
KRFPISLSKQ PWSNIEKENL VKGIKQQYQE MLILNSMNME SDAEGITDSN LMSAITLSDP  240
EFTAEKIRSF IPLVNWNRLA SMYAMGRAGA ECEARWLNCE DSMINHSPWT VMEDKKLLFI  300
VQERGIYNWI DISITLGTHR TPFQCLVRYQ RSLNPHILNK DWTEDEDAKL RVAVEYYGDN  360
WQMVASCLEG RVGPQCSNRW NKTLNPERKK VGRWSVDEDK RLKVAVMLFG AKNWNKIAWF  420
APGRTQVQCR ERWHNCLDPT LNLKPWTAEE DAKLLDARAM HGNCWSKIAA CIPPRTDNQC  480
RRRWKILLPG ELISLQAAAQ IKKTALISNF VDRESERPAI GPNDFTPLIN SNTMFDKIGG  540
AKVRKKRQRY CSLDIHWFSL GYSVFIPLFL VLNYICLLSL EEFAYLHLEN IMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-312374843159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-312374843159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406726.10.0PREDICTED: snRNA-activating protein complex subunit 4-like
RefseqXP_009406727.10.0PREDICTED: snRNA-activating protein complex subunit 4-like
RefseqXP_009406728.10.0PREDICTED: snRNA-activating protein complex subunit 4-like
RefseqXP_009406729.10.0PREDICTED: snRNA-activating protein complex subunit 4-like
RefseqXP_009406730.10.0PREDICTED: snRNA-activating protein complex subunit 4-like
TrEMBLM0TBT60.0M0TBT6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-157myb domain protein 4r1