PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P30650_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family ZF-HD
Protein Properties Length: 95aa    MW: 10602.2 Da    PI: 8.5028
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P30650_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.71.8e-302984359
            ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                            v+Y eC+kNhAas+Gg+a+DGC+Ef+++ geegt+ alkCaACgCHR+FHRr ++ 
  GSMUA_Achr6P30650_001 29 CVKYAECRKNHAASVGGYAIDGCCEFIAD-GEEGTPGALKCAACGCHRSFHRRVQDA 84
                           589*************************8.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-172890IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-283082IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.2E-253180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3623281IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MKRHLLVLRR YEPVVRIHGG RAEFSRRKCV KYAECRKNHA ASVGGYAIDG CCEFIADGEE  60
GTPGALKCAA CGCHRSFHRR VQDAEGECEC ALHRP
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019710028.18e-39mini zinc finger protein 2-like
SwissprotQ0J5F85e-23MIF4_ORYSJ; Mini zinc finger protein 4
TrEMBLM0TBL07e-62M0TBL0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P30650_0011e-62(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-25mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]