PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P22210_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family VOZ
Protein Properties Length: 537aa    MW: 61569.6 Da    PI: 5.658
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P22210_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ300.51.5e-923775221146
                    VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataks 88 
                            pppsafl+pkcalwdc+rpaqgsew+qdycssfhatla+neg+pg+tpvlrp+gi+lkdg+lfaalsakvqgk+vgip+cegaat+ks
  GSMUA_Achr6P22210_001 377 PPPSAFLRPKCALWDCPRPAQGSEWCQDYCSSFHATLAINEGPPGMTPVLRPGGINLKDGPLFAALSAKVQGKNVGIPVCEGAATSKS 464
                            89************************************************************************************** PP

                    VOZ  89 pwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmk 146
                            pwna++lfdl++lege++rewlffdkprrafesgnrkqrslpdy+grgwhesrkq   
  GSMUA_Achr6P22210_001 465 PWNAPDLFDLCVLEGESLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQARI 522
                            ******************************************************9755 PP

Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MGKGSKSVSH QLFKDKARNR VDDLQEMFTD LQSALKESRA ADVAVLEEQV HQMLREWRAE  60
LNQASPATSL QSWLILGGQA NTPDTSDLFS ETLRLLQLSE EEDDATSKLA DLAFRNTPKP  120
EQVEFQQADV GATQGREAAT FYQEQHQFSN CFILMLDERI FMSFLSHLLT HHFSSYLGGV  180
LFGVVVSILG PISILTFNIV HSNIYLHRKA KKGKMTTHFA NLNFMDCGYW HLIFMLFLFY  240
CSYMQWSERC LYDLYSKTEE SEERLCVCVY FPPWVLIIME IESSGFSVVR FFYFEQFYHM  300
NQEVAEQEFL YADHYESNHP NGAHDAAVTC LEGPYHFDYQ QYNMHQELSH DLYINPTEQN  360
TQDVFPHISD VLPAICPPPS AFLRPKCALW DCPRPAQGSE WCQDYCSSFH ATLAINEGPP  420
GMTPVLRPGG INLKDGPLFA ALSAKVQGKN VGIPVCEGAA TSKSPWNAPD LFDLCVLEGE  480
SLREWLFFDK PRRAFESGNR KQRSLPDYNG RGWHESRKQA RIQTRRFKEK CQSQVDQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762943e-35AK376294.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120B09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798281.11e-127PREDICTED: transcription factor VOZ1 isoform X3
RefseqXP_008798282.11e-127PREDICTED: transcription factor VOZ1 isoform X4
SwissprotQ9SGQ09e-93VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM0T9690.0M0T969_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P22210_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.25e-94vascular plant one zinc finger protein