PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P16390_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family LFY
Protein Properties Length: 417aa    MW: 46836.1 Da    PI: 10.0577
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P16390_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY570.25.6e-17413961386
                FLO_LFY   1 mdp.eafsaslfkwdpraaaaapparlleeaavseap....leaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkd 83 
                            mdp +afsa+++kw+pr+a  +p  rll+    +++p      aaa++++++ relee+f++yGvry+tva+i+elGft+stLv+m++
  GSMUA_Achr6P16390_001   1 MDPgDAFSANVYKWEPREAPPHPC-RLLQPLPPPPPPppqpPMAAAQVEEQRPRELEEVFSGYGVRYATVARIGELGFTASTLVGMTE 87 
                            666367***********9885555.44444443333333223334444445588********************************** PP

                FLO_LFY  84 eelddlmkslseifrldllvGeryGikaavraerrrlee............eeaekkrrkll....sedeetaldalsqeglseepvq 155
                             e+dd+m++l+++fr+dll+GeryGikaa+raerrrl +             + + +rr ll     + +++aldalsqeg       
  GSMUA_Achr6P16390_001  88 AEVDDMMATLAHLFRWDLLLGERYGIKAALRAERRRLVDsrllrhhrhddnGDGDPRRRLLLpsdhLHGNNNALDALSQEGAPFRSL- 174
                            ***************************************999999999887566788888884433233456********7543322. PP

                FLO_LFY 156 eekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevar 243
                             ++ a  s++  ++++e++++  +      kk s+ +q+r +kk++        ++ +++++++ +++  erqrehPfivtepgevar
  GSMUA_Achr6P16390_001 175 -HIAARLSEEPVQHDKEAAGSGGEAAAGVAKKDSNGRQQRSSKKHK--------SNGHNKKSNKRRSRRAERQREHPFIVTEPGEVAR 253
                            .223333333333344444444333333333333334443333331........11222233334445679***************** PP

                FLO_LFY 244 gkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkerge 331
                            +kknGLDYLf+Ly+qCr+fLlqvq++a+e+G+kcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkerge
  GSMUA_Achr6P16390_001 254 AKKNGLDYLFHLYDQCRHFLLQVQALAREHGHKCPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGE 341
                            **************************************************************************************** PP

                FLO_LFY 332 nvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                            nvGawrqacykplvai+ar+gwdidavfnahprLsiWYvPtkLrqLChl+rs+a+
  GSMUA_Achr6P16390_001 342 NVGAWRQACYKPLVAISARHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLARSNAN 396
                            ***************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016988.7E-1941395IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MDPGDAFSAN VYKWEPREAP PHPCRLLQPL PPPPPPPPQP PMAAAQVEEQ RPRELEEVFS  60
GYGVRYATVA RIGELGFTAS TLVGMTEAEV DDMMATLAHL FRWDLLLGER YGIKAALRAE  120
RRRLVDSRLL RHHRHDDNGD GDPRRRLLLP SDHLHGNNNA LDALSQEGAP FRSLHIAARL  180
SEEPVQHDKE AAGSGGEAAA GVAKKDSNGR QQRSSKKHKS NGHNKKSNKR RSRRAERQRE  240
HPFIVTEPGE VARAKKNGLD YLFHLYDQCR HFLLQVQALA REHGHKCPTK VTNQVFRYAK  300
KVGASYINKP KMRHYVHCYA LHCLDEEASN ALRRAFKERG ENVGAWRQAC YKPLVAISAR  360
HGWDIDAVFN AHPRLSIWYV PTKLRQLCHL ARSNANASSS SVLAATSDGL PAPPPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1072354073175PROTEIN LEAFY
2vy2_A1e-1072354073175PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009405247.10.0PREDICTED: floricaula/leafy homolog
SwissprotO040641e-165FLLH_POPTR; Floricaula/leafy homolog
TrEMBLM0T7I70.0M0T7I7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P16390_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-104floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]