PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P09880_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family RAV
Protein Properties Length: 289aa    MW: 32229.5 Da    PI: 9.3645
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P09880_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP238.92.2e-1258106155
                    AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkr.krfslgkfgtaeeAakaaiaarkkleg 55 
                            s+ykGV     +grW A+I++      r +r++lg+f  + eAa+a++ a+++++g
  GSMUA_Achr6P09880_001  58 SRYKGVV-PQLNGRWGAQIYE------RtRRVWLGTFSDEAEAARAYDVAAQRFRG 106
                            7899996.6779*******99......44**********99*************98 PP

2B334.92.7e-111882215689
                            TTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                     B3  56 sgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                             ++yvltkGW++Fvk+++Lk+gD+v F ++   e
  GSMUA_Achr6P09880_001 188 AQSYVLTKGWSRFVKEKNLKAGDVVSFWRSTGPE 221
                            356************************8654444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF541717.19E-1658114IPR016177DNA-binding domain
CDDcd000181.84E-2258113No hitNo description
PfamPF008471.4E-758106IPR001471AP2/ERF domain
PROSITE profilePS5103219.04559114IPR001471AP2/ERF domain
SMARTSM003801.7E-2359120IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.104.2E-1959114IPR001471AP2/ERF domain
Gene3DG3DSA:2.40.330.102.3E-10151181IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-20152228IPR015300DNA-binding pseudobarrel domain
CDDcd100176.91E-19152217No hitNo description
SMARTSM010198.1E-10153230IPR003340B3 DNA binding domain
PfamPF023624.3E-8188218IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-12189230IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.515190230IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEGGCVEEVS SDSEKRLQVA PQHFVTEVLQ RMGSGVSVVL DPTPEGGMKA ESRKLPSSRY  60
KGVVPQLNGR WGAQIYERTR RVWLGTFSDE AEAARAYDVA AQRFRGQDAT TNFHPLSETH  120
DDEAAELTFL LAHSKAEIRR TPNDLRSVRD LLFEKVVTPS DVGKLNRLVI PKHHAEKHFP  180
SKSSSSMAQS YVLTKGWSRF VKEKNLKAGD VVSFWRSTGP EKRMYIDRRA GGVVCDRSAP  240
PAIGQLPVVK LFGVDISELP ASGGDAKRGR EMELFPPSQF FERQFIEAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A8e-3115224213129DNA-binding protein RAV1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences (Probable). Functionally redundant with TEM1. {ECO:0000250, ECO:0000269|PubMed:18718758, ECO:0000305}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403983.10.0PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like
SwissprotP822803e-79RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2
TrEMBLM0T5N70.0M0T5N7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P09880_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45638203
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.26e-73related to ABI3/VP1 2
Publications ? help Back to Top
  1. Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S
    RAV genes: regulation of floral induction and beyond.
    Ann. Bot., 2014. 114(7): p. 1459-70
    [PMID:24812253]
  2. Marín-González E, et al.
    SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
    Plant Physiol., 2015. 169(2): p. 1214-24
    [PMID:26243615]
  3. Sun YW, et al.
    Attenuation of Histone Methyltransferase KRYPTONITE-mediated transcriptional gene silencing by Geminivirus.
    Sci Rep, 2015. 5: p. 16476
    [PMID:26602265]
  4. Mittal A,Jiang Y,Ritchie GL,Burke JJ,Rock CD
    AtRAV1 and AtRAV2 overexpression in cotton increases fiber length differentially under drought stress and delays flowering.
    Plant Sci., 2015. 241: p. 78-95
    [PMID:26706061]
  5. Matías-Hernández L, et al.
    TEMPRANILLO Reveals the Mesophyll as Crucial for Epidermal Trichome Formation.
    Plant Physiol., 2016. 170(3): p. 1624-39
    [PMID:26802039]
  6. Li P, et al.
    The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses.
    Physiol Plant, 2017. 159(4): p. 416-432
    [PMID:27747895]