PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P05330_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family G2-like
Protein Properties Length: 422aa    MW: 46040.6 Da    PI: 5.8774
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P05330_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.6e-32207262156
                G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                            k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSMUA_Achr6P05330_001 207 KARRCWSPDLHRRFVNALQILGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 262
                            68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.13204264IPR017930Myb domain
SuperFamilySSF466891.02E-16204265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-28205265IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-26207262IPR006447Myb domain, plants
PfamPF002492.0E-6209260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MASPAELSLD YKPNSYTMIQ KQIGEQPDQT QKIQDFLARL EEERHKIDAF KRELPLCMQL  60
LNNAIECYKQ QLETYQTNQG PRPVLEEFIP LKHMNMDGSD KDPSAHSEKA SWMVSAQLWS  120
PPVDAAKQQP VPPPKETEQA FDVSPKLSLD TKQRNGGAFL PFSKEKSKAA RSASRALSEL  180
ALASPEKVGG SSSATEGQAA APPTHRKARR CWSPDLHRRF VNALQILGGS QVATPKQIRE  240
LMKVDGLTND EVKSHLQKYR LHTRRPAPAP QAAAAAAPQL VVLGGIWVPP EYATSAAAAA  300
AAGPAIYGAH AAPAHYCAAT PVPQEFYPPP PPVAHHHHLH PPLHRGAAAY KGRSSGSPES  360
EVRSGGERSE SIEEEEEGEE REEDEEEEEE EEGTPSMEEK ALLPLPVKAE DGNGGGNVAL  420
KF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-14207260154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14207260154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14207260154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14207260154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14207260255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403477.10.0PREDICTED: myb family transcription factor EFM-like isoform X1
SwissprotQ9ZQ851e-108EFM_ARATH; Myb family transcription factor EFM
TrEMBLM0T4D10.0M0T4D1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P05330_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-92G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]