PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P25700_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 355aa    MW: 36825.4 Da    PI: 6.0099
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P25700_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.8e-10193251563
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            kr++r   NR +A rs +RK  +i+eLe+ v ++++e ++L  +l +l+     l++e+
  GSMUA_Achr5P25700_001 193 KRAKRILANRQSAARSKERKMRYIAELERQVHTFQTEATTLSAQLTMLQRDNNGLTAEN 251
                            9***********************************************99998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-17189253IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.473191254IPR004827Basic-leucine zipper domain
PfamPF001702.4E-8193249IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-11193248No hitNo description
SuperFamilySSF579598.44E-11193247No hitNo description
CDDcd147034.05E-24194245No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MDKSPVPDGG GDGGNGVGLP PHSSRYPASG SPTASSSSQP PSDSDHFGHP APSEGRLFSH  60
DVSRMPDFPP RNPGHRRAHS EILSLPDDIS FDSDLGVVGS HDGPSLSDEA EEDLVSMYMD  120
GEKFGSVAAT AGLSNGESSR SALIRHHHSQ SLDGSTAIKS ELLMSGGEGP STAEAKKAMS  180
AAKLAELALV DPKRAKRILA NRQSAARSKE RKMRYIAELE RQVHTFQTEA TTLSAQLTML  240
QRDNNGLTAE NSELKLRLQT MEQQVHLQDA LNEALREEVQ HLKLATGQID AVPPGGTPTS  300
AAPHPSSTSA TATVTSESTA TAAAAASSSA AAPTSSSAAT AAAAAAAAAS SPWQR
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009402686.11e-178PREDICTED: transcription factor RF2a-like
RefseqXP_009402687.11e-178PREDICTED: transcription factor RF2a-like
RefseqXP_018681530.11e-178PREDICTED: transcription factor RF2a-like
SwissprotQ040881e-111POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0T1P50.0M0T1P5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P25700_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-117bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]