PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P14030_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family B3
Protein Properties Length: 666aa    MW: 77263.8 Da    PI: 9.3073
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P14030_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.74.9e-145846433798
                            EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                     B3  37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                            ++ +  +r+Wev +  ++ ++   +++GWk+Fv +n+LkegD +vF+l+++++ +++v+++r
  GSMUA_Achr5P14030_001 584 VVLSYGSRTWEVIY--CGDQSFQRFGQGWKNFVTDNNLKEGDGCVFELMDTENIQFKVQILR 643
                            5566778*******..88888888*************************9999999999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.89E-17549643IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-15549643IPR015300DNA-binding pseudobarrel domain
CDDcd100179.46E-17551643No hitNo description
PROSITE profilePS5086313.056552645IPR003340B3 DNA binding domain
SMARTSM010198.8E-12553645IPR003340B3 DNA binding domain
PfamPF023629.6E-12567644IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MRKVDAVSCC CCYCLVAVKR CLRFWPQIKG WRGLPQGGRR AEGCATVGRI GVSPCVCLSL  60
SLSLSRTPTH TGGDCDTICR IQLPVLFAYA HPKGKMMLIA VVDLFNRREL FFHPMVLLGS  120
RYCLQRRHTE RERERERERD TESARXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  360
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  420
XXXXXXXXXX XXXXXXXXXX XXXXRERERE RERERDTESA RNQTPTRRSR RTNVVSSSSS  480
MRDPLAGSST AQPTHRKTSP GKLAVNCEKR DKTNIRSPTT VQQSLEHATQ EKIVPIEHAM  540
QEKIVPLSGN RFFTCILSTT SCYMYRMALP KRIRELLPLS TVPVVLSYGS RTWEVIYCGD  600
QSFQRFGQGW KNFVTDNNLK EGDGCVFELM DTENIQFKVQ ILRGDLPAFR AGGGDGQSSD  660
EVIVID
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1444454RERERERERER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0SYD21e-139M0SYD2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P14030_0011e-140(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89543545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-07B3 family protein