PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P12810_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 562aa    MW: 60101.1 Da    PI: 7.7854
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P12810_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS323.83.5e-991875623374
                   GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                            + Ll+ A a+++g+ e+a   La l+  a+ +gd+ qRl+a+++ AL + ++   + + + +p+ ++    s+e++aa+++++e+sP+
  GSMUA_Achr5P12810_001 187 TMLLDTAVAIADGNVEAAAGNLAVLKRAANHRGDAEQRLTAVMLPALVSCMNP--PPTGNFCPSIAEL--CSAEHFAATQVLYELSPC 270
                            57999***********************************************9..7777766555544..599*************** PP

                   GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.....egppslRiTgvgspesg....skeeleetgerLakfA 169
                            +k++ ++aN aIlea++ + ++Hi+Df+ +qG+Q++++l+aLa+R+     + +p +RiT+v++p+s     +  +l+++g++++k+A
  GSMUA_Achr5P12810_001 271 FKLGLIAANLAILEATKDHPKIHILDFQFGQGGQYLTFLHALAERQrlrptARSPVIRITAVADPSSPftrnNGGNLRAVGHQIEKLA 358
                            ********************************************9988777779**********99888999999************* PP

                   GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                            e+ g+ ++f v v++r +dl+  +L ++pgEalaVnl+++l r++desvs +++rde+L+ v+ l+P+vv +veqe++++++ F++rf
  GSMUA_Achr5P12810_001 359 ERAGLAVRFGV-VHRRPADLDAAALGCEPGEALAVNLAFALARIPDESVSPSNPRDELLRRVRALRPRVVAMVEQEINTSTAAFAARF 445
                            **********9.79************************************************************************** PP

                   GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                             ea+ +y al++sl+a+++r+s er+ vE+  l+r++vn va+ega+r+er+e ++kWr+r+++aGF p+p++  + + +k+ l+ v 
  GSMUA_Achr5P12810_001 446 GEACAHYGALLESLDATMARDSAERARVEAW-LARRAVNSVATEGADRVERCEVFGKWRARMGMAGFDPLPFGPAMIEPVKAKLASVR 532
                            *****************************87.99****************************************************** PP

                   GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             + g++++ee g l + Wkdr L+++S+Wr
  GSMUA_Achr5P12810_001 533 sNPGFTIKEEGGRLGFAWKDRVLTVASSWR 562
                            99***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.481159541IPR005202Transcription factor GRAS
PfamPF035141.2E-96187562IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MASGFSGRCG VQSPIATRSE AGTGAILKRS LTERERLQQQ QQMQLQDALR SVKQRTLLAS  60
SASSHLPPPP PVDLSSGSSS LTSSNFPASG FARRREMFFS VTQTAAGSGS DNRPSAAIQD  120
RLQELERQLF LDEDDEEDAV SASGSAVTTA EWSDAMQQLT SPPLPPPAAA VAAPNQLSPS  180
PTNSSSTMLL DTAVAIADGN VEAAAGNLAV LKRAANHRGD AEQRLTAVML PALVSCMNPP  240
PTGNFCPSIA ELCSAEHFAA TQVLYELSPC FKLGLIAANL AILEATKDHP KIHILDFQFG  300
QGGQYLTFLH ALAERQRLRP TARSPVIRIT AVADPSSPFT RNNGGNLRAV GHQIEKLAER  360
AGLAVRFGVV HRRPADLDAA ALGCEPGEAL AVNLAFALAR IPDESVSPSN PRDELLRRVR  420
ALRPRVVAMV EQEINTSTAA FAARFGEACA HYGALLESLD ATMARDSAER ARVEAWLARR  480
AVNSVATEGA DRVERCEVFG KWRARMGMAG FDPLPFGPAM IEPVKAKLAS VRSNPGFTIK  540
EEGGRLGFAW KDRVLTVASS WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4220456222375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009400202.10.0PREDICTED: scarecrow-like protein 8
TrEMBLM0SY100.0M0SY10_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P12810_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-95SCARECROW-like 8