PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P07290_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Dof
Protein Properties Length: 274aa    MW: 29720.8 Da    PI: 6.4983
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P07290_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.5e-393191262
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           +e+a++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rkn++ s
  GSMUA_Achr5P07290_001 31 PEQAVECPRCQSTNTKFCYYNNYSLSQPRYFCKGCRRYWTRGGSLRNVPVGGGCRKNRRPS 91
                           7899*****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.0E-333389IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-243489IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0593589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGDLLPLEEV GSGSSTAQQL QQQERRGRPQ PEQAVECPRC QSTNTKFCYY NNYSLSQPRY  60
FCKGCRRYWT RGGSLRNVPV GGGCRKNRRP SSSLSSSSSS TATTLASKRR SQQSLATNFN  120
LPLPGVIPPP HSFDPDGLSS PFARIHNQQH TPRQLLDDHG AFLLGNPAAP EILNAIATPN  180
SFGNIYYGYG SNASIEEEAA IPRDGGLCGA TTTAATTVTT AQASCSTMDE GGNEVFTGLQ  240
WQLPGDGNMD HMDFGRDHQW NEVGSTWPGE MVDI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399889.21e-153PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLM0SWF80.0M0SWF8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P07290_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-32Dof family protein