PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P26400_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 584aa    MW: 62101.3 Da    PI: 8.8273
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P26400_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS344.42e-1052055842374
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++ Lle A a+++g+le a+a L  l+  a+p+gd+ qRl+a+++ AL +rl    +  +++lp  +     s+e++aa+++++e+sP
  GSMUA_Achr4P26400_001 205 RQMLLETAAAIADGNLETATANLVVLKRVANPRGDAEQRLTAVMVDALISRLKL-PQAGSSSLPIAALC---SAEHFAATQMLYELSP 288
                            689*************************************************98.33344566777776...9*************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.....egppslRiTgvgspesg.....skeeleetgerLak 167
                            ++k++ +taN aIlea++++ ++Hi+Dfd++qG+Q++ Ll+aLa+R      +g+pslRiT+v++p+s      s  +l+++g+rL+k
  GSMUA_Achr4P26400_001 289 CFKLGLITANLAILEATKEQPMIHILDFDVGQGGQYAVLLHALAERHhlrpaAGAPSLRITAVSDPTSPftnnnSGGNLRAVGNRLEK 376
                            **********************************************99988999***********998789999999*********** PP

                   GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                            +Ae+ g+ ++fnv v+ r ++l+ ++Lr++pgEal+Vnl+++l r++desvs +++rde+L+ v+ l+P+vv +veqe++++++ F++
  GSMUA_Achr4P26400_001 377 LAERAGLAVRFNV-VHLRAAELDASALRCEPGEALVVNLAFALSRVPDESVSPTNPRDEILRRVRALRPRVVALVEQEINTSTAAFAA 463
                            ************9.7999********************************************************************** PP

                   GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                            rf ea+ +y al++sl+a+++r+s +r+ vE+  l+r++ n va+ega+r+er+e ++kWr+r+++aGF +vpl+  + + +k+ l+ 
  GSMUA_Achr4P26400_001 464 RFGEACAHYGALLESLDATVARDSVQRARVEAG-LARRALNSVANEGADRVERCEVFGKWRARMGMAGFDSVPLGPAVIEPVKARLAS 550
                            *********************************.999*************************************************** PP

                   GRAS 344 vk.sdgyrveee.sgslv.lgWkdrpLvsvSaWr 374
                            +  ++g+++ +e  g  + +gWk+r L+++S+Wr
  GSMUA_Achr4P26400_001 551 IRsNRGFTMRDEaGGHGLgFGWKGRVLTVASSWR 584
                            **9******97733333459*************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.487178561IPR005202Transcription factor GRAS
PfamPF035146.8E-103205584IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MASGFPGREL GYGVRLPIPA RSEAGNGGLL KRSLTEMDRL QLQQQMQLQH TFFLRSVKQR  60
TLFNSPASPH FSPPLPPADL SSGSSSSLIS AKLTQDGLAR SREQSSAPQV AASGAESRPS  120
AAVRDRLQEL ERRLLLDEEE GEGDVSTSGS AVTTAEWSEA MQQLITPPTS AKNPLSASPT  180
NSSSTTVSSS ASCSPSSSSV ASSSRQMLLE TAAAIADGNL ETATANLVVL KRVANPRGDA  240
EQRLTAVMVD ALISRLKLPQ AGSSSLPIAA LCSAEHFAAT QMLYELSPCF KLGLITANLA  300
ILEATKEQPM IHILDFDVGQ GGQYAVLLHA LAERHHLRPA AGAPSLRITA VSDPTSPFTN  360
NNSGGNLRAV GNRLEKLAER AGLAVRFNVV HLRAAELDAS ALRCEPGEAL VVNLAFALSR  420
VPDESVSPTN PRDEILRRVR ALRPRVVALV EQEINTSTAA FAARFGEACA HYGALLESLD  480
ATVARDSVQR ARVEAGLARR ALNSVANEGA DRVERCEVFG KWRARMGMAG FDSVPLGPAV  540
IEPVKARLAS IRSNRGFTMR DEAGGHGLGF GWKGRVLTVA SSWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4222358422375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397918.10.0PREDICTED: scarecrow-like protein 8
TrEMBLM0SSA20.0M0SSA2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P26400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.18e-92SCARECROW-like 8