PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P22960_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 382aa    MW: 41162.2 Da    PI: 7.7577
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P22960_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP120.22.4e-37672082133
                    TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt......ssssasec....eaesss 79 
                             g+kdrhsk++T++g+RdRRvRls+++a++f+dLqd+LG+d++sk+ieWL+++a +ai el+ +      +++s  e+     ++++s
  GSMUA_Achr4P22960_001  67 SGGKDRHSKVYTAKGLRDRRVRLSVSTAIQFYDLQDRLGYDQPSKAIEWLIKAAAAAINELPPLdgfpklPQPSGDEVmkadPDVERS 154
                            689*************************************************************999988444443344556667777 PP

                    TCP  80 ssasnsssgkaaksaakskksqksaasalnlakesrakarararertrekmrik 133
                             s++++++++ ++++ +s+ s++s+ s l+l++  ++ a   + e+++  ++i+
  GSMUA_Achr4P22960_001 155 YSQQQQQQQHPSTKSGCSSTSDTSKGSGLSLSNGANNVAAVAEGEENSGHNCIQ 208
                            777777777888888899999999999999999555444444455555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-3568189IPR005333Transcription factor, TCP
PROSITE profilePS5136932.97169127IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDLENTHASK RSRTVGNGGQ ASKIGRKEHQ DEDEEDRERK GGGADAGRVA PWLHHPSSRI  60
FRVSRASGGK DRHSKVYTAK GLRDRRVRLS VSTAIQFYDL QDRLGYDQPS KAIEWLIKAA  120
AAAINELPPL DGFPKLPQPS GDEVMKADPD VERSYSQQQQ QQQHPSTKSG CSSTSDTSKG  180
SGLSLSNGAN NVAAVAEGEE NSGHNCIQKQ IPTAIYFGQA GLFAQSQKSQ QLPSGFSSQS  240
HFGNSCPMGM LPFNVAATGD HQEMQQFSLL QDNFFPVSAV AAMANYNLNF SISSGLAGFN  300
RGTLQSNSPA QMPQEHHHSH NHLQRLSSTV DGSNLQFFGA AAGSAAAATN AENQFPAGFG  360
DHLQLCYGDG YRQSDLKGKG KN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-2674128155Putative transcription factor PCF6
5zkt_B1e-2674128155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00639PBMTransfer from Lj6g3v1946420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398327.10.0PREDICTED: transcription factor PCF6-like
RefseqXP_009398328.10.0PREDICTED: transcription factor PCF6-like
RefseqXP_009398329.10.0PREDICTED: transcription factor PCF6-like
TrEMBLM0SRA70.0M0SRA7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P22960_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30943271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.21e-44TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2